Primary Information |
|---|
| BoMiProt ID | Bomi9626 |
|---|
| Protein Name | Synaptic vesicle 2-related protein/SV2-related protein |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q1JP63 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001068909.1 |
|---|
| Aminoacid Length | 548 |
|---|
| Molecular Weight | 60748 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | SVOP |
|---|
| Gene ID | 510256 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | transmembrane transporter activity at nerve terminals responsible for synaptic vesicle fusion.SV2 appears to facilitate the progression to a release-competent state after vesicle docking at the plasma membrane. |
|---|
| PTMs | phosphorylation on Ser |
|---|
| Significance of PTMs | . The three asparagines in the highly glycosylated lumenal domain between TM 7 and 8 domain are extensively modified with keratan sulfate moieties .This feature suggested that SV2 might provide a gel matrix to the inside of synaptic vesicles that would facilitate the concentration and release of transmitters.interaction of SV2 and synaptotagmin is regulated by phosphorylation.A conserved threonine in the amino terminus of all SV2s (Thr84 in SV2A) is a substrate for casein kinase 1. Phosphorylation of SV2A at this site increases binding to synaptotagmin. |
|---|
| Additional Comments | SV2 is part of a protein complex that includes the synaptic vesicle protein synaptotagmin, the primary calcium sensor in regulated secretion.Loss of synaptotagmin abolishes synchronized transmitter release in response to action potentials |
|---|
| Linking IDs | Bomi9626 |
|---|
| Bibliography | Ciruelas K, Marcotulli D, Bajjalieh SM. Synaptic vesicle protein 2: A multi-faceted regulator of secretion. Semin Cell Dev Biol. 2019 Nov;95:130-141. doi: 10.1016/j.semcdb.2019.02.003. Epub 2019 Mar 21. PMID: 30826548; PMCID: PMC6754320. |
|---|
| Protein Function | transmembrane transporter activity at nerve terminals responsible for synaptic vesicle fusion.SV2 appears to facilitate the progression to a release-competent state after vesicle docking at the plasma membrane. |
|---|
| PTMs | phosphorylation on Ser |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q1JP63|SVOP_BOVIN Synaptic vesicle 2-related protein OS=Bos taurus OX=9913 GN=SVOP PE=2 SV=1
MEEDLFQLRQLPVVKFRRTGESARS*25EDDTAS*31GEHEVQIEGVRAGLEAVELDDGAAVPKEF
ANPTDDTFMVEDAVEAIGFGKFQWKLSVLTGLAWMADAMEMMILSILAPQLHCEWRLPSW
QVALLTSVVFVGMMSSSTLWGNISDQYGRKTGLKISVLWTLYYGILSAFAPVYSWILVLR
GLVGFGIGGVPQSVTLYAEFLPMKARAKCILLIEVFWAIGTVFEVVLAVFVMPSLGWRWL
LILSAVPLLLFAVLCFWLPESARYDVLSGNQEKAIATLKRIATENGAPMPLGKLIISRQE
DRGKMRDLFTPHFRWTTLLLWFIWFSNAFSYYGLVLLTTELFQAGDVCSISSRKKAVEAK
CSLACEYLSEEDYMDLLWTTLSEFPGVLVTLWIIDRLGRKKTMALCFVVFSFCSLLLFIC
VGRNMLTLLLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIAQ
VMLESSVYLTLAVYSGCCLLAALASCFLPIETKGRGLQESSHREWGQEMVGRGAHGTGVA
RS*642NSGSQE |
|---|
| Predicted Disorder Regions | 1-5, 19-66, 525-548 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | 10TMHs; (86-108), (120-142), (155-177),(181-203), (210-232), (236-258), (315-337), (376-394), (407-429), (486-508) |
|---|
| Significance of PTMs | . The three asparagines in the highly glycosylated lumenal domain between TM 7 and 8 domain are extensively modified with keratan sulfate moieties .This feature suggested that SV2 might provide a gel matrix to the inside of synaptic vesicles that would facilitate the concentration and release of transmitters.interaction of SV2 and synaptotagmin is regulated by phosphorylation.A conserved threonine in the amino terminus of all SV2s (Thr84 in SV2A) is a substrate for casein kinase 1. Phosphorylation of SV2A at this site increases binding to synaptotagmin. |
|---|
| Additional Comments | SV2 is part of a protein complex that includes the synaptic vesicle protein synaptotagmin, the primary calcium sensor in regulated secretion.Loss of synaptotagmin abolishes synchronized transmitter release in response to action potentials |
|---|
| Linking IDs | |
|---|
| Bibliography | Ciruelas K, Marcotulli D, Bajjalieh SM. Synaptic vesicle protein 2: A multi-faceted regulator of secretion. Semin Cell Dev Biol. 2019 Nov;95:130-141. doi: 10.1016/j.semcdb.2019.02.003. Epub 2019 Mar 21. PMID: 30826548; PMCID: PMC6754320. |
|---|
