Search by BoMiProt ID - Bomi9065


Primary Information

BoMiProt ID Bomi9065
Protein Name Serine/threonine-protein phosphatase CPPED1/Calcineurin-like phosphoesterase domain-containing protein 1
Organism Bos taurus
Uniprot IDQ58DC0
Milk FractionExosomes
Ref Sequence ID NP_001026941.2
Aminoacid Length 313
Molecular Weight 35410
FASTA Sequence Download
Gene Name CPPED1
Gene ID 537938
Protein Existence Status Reviewed

Secondary Information

Protein Function  Higher CPPED1 levels may inhibit PI3K-AKT pathway maintaining pregnancy. 
Biochemical Properties CPPED1 has a calcineurin‐like phosphoesterase domain and is inhibited by trifluoperazine, which suggests that CPPED1 could belong to the PP2A or PP2B families of PPPs.
PTMs Phosphorylation at Ser
Additional Comments Silencing of CPPED1 expression in the human trophoblast cell line HTR8/SVneo leads to up‐regulation of negative regulators of the PI3K pathway.CPPED1 expression levels are down‐regulated in non‐invasive bladder cancer tissue, whereas overexpression is associated with regression in tumour size.
Linking IDs Bomi9065
Bibliography 1.Haapalainen AM, Daddali R, Hallman M, Rämet M. Human CPPED1 belongs to calcineurin-like metallophosphoesterase superfamily and dephosphorylates PI3K-AKT pathway component PAK4. J Cell Mol Med. 2021 May 19;25(13):6304–17. doi: 10.1111/jcmm.16607. Epub ahead of print. PMID: 34009729; PMCID: PMC8366450. 2.Haapalainen AM, Karjalainen MK, Daddali R, et al. Expression of CPPED1 in human trophoblasts is associated with timing of term birth. J Cell Mol Med. 2018;22:968‐981. 3.Zhuo DX, Zhang XW, Jin B, et al. CSTP1, a novel protein phosphatase, blocks cell cycle, promotes cell apoptosis, and suppresses tumor growth of bladder cancer by directly dephosphorylating Akt at Ser473 site. PLoS One. 2013;8:e65679.
Protein Function  Higher CPPED1 levels may inhibit PI3K-AKT pathway maintaining pregnancy. 
Biochemical Properties CPPED1 has a calcineurin‐like phosphoesterase domain and is inhibited by trifluoperazine, which suggests that CPPED1 could belong to the PP2A or PP2B families of PPPs.
PTMs Phosphorylation at Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q58DC0|CPPED_BOVIN Serine/threonine-protein phosphatase CPPED1 OS=Bos taurus OX=9913 GN=CPPED1 PE=2 SV=1 MS*2TAEAGGVFHRARGRTLDAFSSEKEREWKGPFYFIQGADPQFGLMKAWATGDCDNGGDE WEQEIRLAEQAVQAINKLNPKPKFFVLCGDLVHAMPGRPWRKEQTEDLQRVLRTVDSDIP LVLVSGNHDVGNVPTPETIAEFQRTWGDDYFSFWVGGVLFLVLNSQFLYDASRCPALKQE HDHWLDQQLRIAGQRACRHAVVFQHIPLFLQSIGEDDDYFNLTKSVRKEMADKFVEAGVK AVFSGHYHRNAGGTYRNLDMVVSSAIGCQLGTDTHGLRVVVVTAEKITHRYYS*293LDELSEK GIEDDLMDLLKEN
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments Silencing of CPPED1 expression in the human trophoblast cell line HTR8/SVneo leads to up‐regulation of negative regulators of the PI3K pathway.CPPED1 expression levels are down‐regulated in non‐invasive bladder cancer tissue, whereas overexpression is associated with regression in tumour size.
Linking IDs
Bibliography 1.Haapalainen AM, Daddali R, Hallman M, Rämet M. Human CPPED1 belongs to calcineurin-like metallophosphoesterase superfamily and dephosphorylates PI3K-AKT pathway component PAK4. J Cell Mol Med. 2021 May 19;25(13):6304–17. doi: 10.1111/jcmm.16607. Epub ahead of print. PMID: 34009729; PMCID: PMC8366450. 2.Haapalainen AM, Karjalainen MK, Daddali R, et al. Expression of CPPED1 in human trophoblasts is associated with timing of term birth. J Cell Mol Med. 2018;22:968‐981. 3.Zhuo DX, Zhang XW, Jin B, et al. CSTP1, a novel protein phosphatase, blocks cell cycle, promotes cell apoptosis, and suppresses tumor growth of bladder cancer by directly dephosphorylating Akt at Ser473 site. PLoS One. 2013;8:e65679.