Primary Information |
|---|
| BoMiProt ID | Bomi9065 |
|---|
| Protein Name | Serine/threonine-protein phosphatase CPPED1/Calcineurin-like phosphoesterase domain-containing protein 1 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q58DC0 |
|---|
| Milk Fraction | Exosomes |
|---|
| Ref Sequence ID | NP_001026941.2 |
|---|
| Aminoacid Length | 313 |
|---|
| Molecular Weight | 35410 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | CPPED1 |
|---|
| Gene ID | 537938 |
|---|
| Protein Existence Status | Reviewed |
|---|
Secondary Information |
|---|
| Protein Function | Higher CPPED1 levels may inhibit PI3K-AKT pathway maintaining pregnancy. |
|---|
| Biochemical Properties | CPPED1 has a calcineurin‐like phosphoesterase domain and is inhibited by trifluoperazine, which suggests that CPPED1 could belong to the PP2A or PP2B families of PPPs. |
|---|
| PTMs | Phosphorylation at Ser |
|---|
| Additional Comments | Silencing of CPPED1 expression in the human trophoblast cell line HTR8/SVneo leads to up‐regulation of negative regulators of the PI3K pathway.CPPED1 expression levels are down‐regulated in non‐invasive bladder cancer tissue, whereas overexpression is associated with regression in tumour size. |
|---|
| Linking IDs | Bomi9065 |
|---|
| Bibliography | 1.Haapalainen AM, Daddali R, Hallman M, Rämet M. Human CPPED1 belongs to calcineurin-like metallophosphoesterase superfamily and dephosphorylates PI3K-AKT pathway component PAK4. J Cell Mol Med. 2021 May 19;25(13):6304–17. doi: 10.1111/jcmm.16607. Epub ahead of print. PMID: 34009729; PMCID: PMC8366450. 2.Haapalainen AM, Karjalainen MK, Daddali R, et al. Expression of CPPED1 in human trophoblasts is associated with timing of term birth. J Cell Mol Med. 2018;22:968‐981. 3.Zhuo DX, Zhang XW, Jin B, et al. CSTP1, a novel protein phosphatase, blocks cell cycle, promotes cell apoptosis, and suppresses tumor growth of bladder cancer by directly dephosphorylating Akt at Ser473 site. PLoS One. 2013;8:e65679. |
|---|
| Protein Function | Higher CPPED1 levels may inhibit PI3K-AKT pathway maintaining pregnancy. |
|---|
| Biochemical Properties | CPPED1 has a calcineurin‐like phosphoesterase domain and is inhibited by trifluoperazine, which suggests that CPPED1 could belong to the PP2A or PP2B families of PPPs. |
|---|
| PTMs | Phosphorylation at Ser |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q58DC0|CPPED_BOVIN Serine/threonine-protein phosphatase CPPED1 OS=Bos taurus OX=9913 GN=CPPED1 PE=2 SV=1
MS*2TAEAGGVFHRARGRTLDAFSSEKEREWKGPFYFIQGADPQFGLMKAWATGDCDNGGDE
WEQEIRLAEQAVQAINKLNPKPKFFVLCGDLVHAMPGRPWRKEQTEDLQRVLRTVDSDIP
LVLVSGNHDVGNVPTPETIAEFQRTWGDDYFSFWVGGVLFLVLNSQFLYDASRCPALKQE
HDHWLDQQLRIAGQRACRHAVVFQHIPLFLQSIGEDDDYFNLTKSVRKEMADKFVEAGVK
AVFSGHYHRNAGGTYRNLDMVVSSAIGCQLGTDTHGLRVVVVTAEKITHRYYS*293LDELSEK
GIEDDLMDLLKEN |
|---|
| Predicted Disorder Regions | NA |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Additional Comments | Silencing of CPPED1 expression in the human trophoblast cell line HTR8/SVneo leads to up‐regulation of negative regulators of the PI3K pathway.CPPED1 expression levels are down‐regulated in non‐invasive bladder cancer tissue, whereas overexpression is associated with regression in tumour size. |
|---|
| Linking IDs | |
|---|
| Bibliography | 1.Haapalainen AM, Daddali R, Hallman M, Rämet M. Human CPPED1 belongs to calcineurin-like metallophosphoesterase superfamily and dephosphorylates PI3K-AKT pathway component PAK4. J Cell Mol Med. 2021 May 19;25(13):6304–17. doi: 10.1111/jcmm.16607. Epub ahead of print. PMID: 34009729; PMCID: PMC8366450. 2.Haapalainen AM, Karjalainen MK, Daddali R, et al. Expression of CPPED1 in human trophoblasts is associated with timing of term birth. J Cell Mol Med. 2018;22:968‐981. 3.Zhuo DX, Zhang XW, Jin B, et al. CSTP1, a novel protein phosphatase, blocks cell cycle, promotes cell apoptosis, and suppresses tumor growth of bladder cancer by directly dephosphorylating Akt at Ser473 site. PLoS One. 2013;8:e65679. |
|---|
