Primary Information |
|---|
| BoMiProt ID | Bomi8432 |
|---|
| Protein Name | Protein THEMIS/Thymocyte-expressed molecule involved in selection |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | A5D789 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001091585.1 |
|---|
| Aminoacid Length | 641 |
|---|
| Molecular Weight | 73132 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | THEMIS |
|---|
| Gene ID | 540554 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | Plays a critical requirement for THEMIS during thymocyte positive selection, implicating THEMIS in signaling downstream of the T cell antigen receptor (TCR) |
|---|
| Biochemical Properties | THEMIS, a recently identified T-lineage-restricted protein, is the founding member of a large metazoan protein family. |
|---|
| PTMs | Phosphorylation at Ser |
|---|
| Significance of PTMs | Phosphorylated on Tyr residues quickly after TCR stimulation |
|---|
| Additional Comments | THEMIS is constitutively bound to the tyrosine phosphatases SHP1 or SHP2, provides a mechanism for THEMIS action. |
|---|
| Linking IDs | Bomi8432 |
|---|
| Bibliography | 1.Choi S, Cornall R, Lesourne R, Love PE. THEMIS: Two Models, Different Thresholds. Trends Immunol. 2017 Sep;38(9):622-632. doi: 10.1016/j.it.2017.06.006. Epub 2017 Jul 8. PMID: 28697966; PMCID: PMC5788012. 2.Gascoigne NR, Acuto O. THEMIS: a critical TCR signal regulator for ligand discrimination. Curr Opin Immunol. 2015 Apr;33:86-92. doi: 10.1016/j.coi.2015.01.020. Epub 2015 Feb 18. PMID: 25700024. |
|---|
| Protein Function | Plays a critical requirement for THEMIS during thymocyte positive selection, implicating THEMIS in signaling downstream of the T cell antigen receptor (TCR) |
|---|
| Biochemical Properties | THEMIS, a recently identified T-lineage-restricted protein, is the founding member of a large metazoan protein family. |
|---|
| PTMs | Phosphorylation at Ser |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|A5D789|THMS1_BOVIN Protein THEMIS OS=Bos taurus OX=9913 GN=THEMIS PE=2 SV=1
MALSLEEFIHSLDLRTLPRVLEIQSGFYFEGSIYEMFGNECCLSTGEVIKITDLKIKKIM
AEICEHVEGCVSPQSFELPMNFPGLFKIVADTTPYLTMEEITKANHIRPSRPNHPCFYHQ
KDIKLENLIIKKGERIMLNSVEEINGEIMVNCSVLRNHQNHSFTLPLSQEGEFYECEDEH
IYTLKEIIQWKIPKNRTRTVILTGFSAKWDSTNPFPRGFYGAVILKPVYEIQAVMKFRKD
IVRILPSLDVEVKDITDSYDANWFLQVLSTQDLYEMANKQFPIVAEVIEAPQGNQLPISI
LQPGKTIVIHKKCQASKILASEIRSNSSKRHFLIPTSYKGKFKRRPREFPTAYDLEIAKS
EKEPLHVVATKAFHSPFEELSSVSVGDEFLVHHSQTTEVLCEGIKKVMDGLACEKILKNS
REVALLPLYMDGGFVEVIHDKKLYQISELCAQFRLPFNVKVSVRDLFIEKDILAAIPGLQ
LEESITNSYLLISDLANPKKCWEIPVGRVNMTVQLVNNFSGDTGSFLVSTLVEEITEEQY
YLIRRYEKSFLHPPPRPPKHPSVEKIELTPLSLAKQKTVNLPKS*584PKSVHVDRSKKLYSNQ
AGLDSKVPAGCQNDLADLEKEKRKTEATAVTEIFKTEEHKK
|
|---|
| Predicted Disorder Regions | 576-641 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | Phosphorylated on Tyr residues quickly after TCR stimulation |
|---|
| Additional Comments | THEMIS is constitutively bound to the tyrosine phosphatases SHP1 or SHP2, provides a mechanism for THEMIS action. |
|---|
| Linking IDs | |
|---|
| Bibliography | 1.Choi S, Cornall R, Lesourne R, Love PE. THEMIS: Two Models, Different Thresholds. Trends Immunol. 2017 Sep;38(9):622-632. doi: 10.1016/j.it.2017.06.006. Epub 2017 Jul 8. PMID: 28697966; PMCID: PMC5788012. 2.Gascoigne NR, Acuto O. THEMIS: a critical TCR signal regulator for ligand discrimination. Curr Opin Immunol. 2015 Apr;33:86-92. doi: 10.1016/j.coi.2015.01.020. Epub 2015 Feb 18. PMID: 25700024. |
|---|
