Primary Information |
|---|
| BoMiProt ID | Bomi5920 |
|---|
| Protein Name | GA-binding protein subunit beta-2 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q0V8G2 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001069710.1 |
|---|
| Aminoacid Length | 447 |
|---|
| Molecular Weight | 48475 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | GABPB2 |
|---|
| Gene ID | 540818 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | It may act as transcription factor. |
|---|
| Biochemical Properties | It has the ability to interact with purine rich GA repeats.Heterotetramer of two alpha and two beta subunits. The C-terminal is necessary for the formation of a heterotetrameric GABP-alpha-2/beta-2 complex, and also facilitates homotypic dimerization.Interacts with ADGRB2.Contains nuclear localization sequence (NLS, aa 243–319) for nuclear entry. |
|---|
| PTMs | Phosphorylation on Ser |
|---|
| Significance of PTMs | Lats1 Binds to and Promotes the Phosphorylation of GABPb, Inhibiting the homodimerization and nuclear localization of GABPb. |
|---|
| Linking IDs | Bomi5920 |
|---|
| Bibliography | 1.Wu H, Xiao Y, Zhang S, Ji S, Wei L, Fan F, Geng J, Tian J, Sun X, Qin F, Jin C, Lin J, Yin ZY, Zhang T, Luo L, Li Y, Song S, Lin SC, Deng X, Camargo F, Avruch J, Chen L, Zhou D. The Ets transcription factor GABP is a component of the hippo pathway essential for growth and antioxidant defense. Cell Rep. 2013 May 30;3(5):1663-77. doi: 10.1016/j.celrep.2013.04.020. Epub 2013 May 16. PMID: 23684612; PMCID: PMC3855275. 2.Bovine Genome Sequencing and Analysis Consortium, Elsik, C. G., Tellam, R. L., Worley, K. C., Gibbs, R. A., Muzny, D. M., Weinstock, G. M., Adelson, D. L., Eichler, E. E., Elnitski, L., Guigó, R., Hamernik, D. L., Kappes, S. M., Lewin, H. A., Lynn, D. J., Nicholas, F. W., Reymond, A., Rijnkels, M., Skow, L. C., Zdobnov, E. M., … Zhao, F. Q. (2009). The genome sequence of taurine cattle: a window to ruminant biology and evolution. Science (New York, N.Y.), 324(5926), 522–528. https://doi.org/10.1126/science.1169588 |
|---|
| Protein Function | It may act as transcription factor. |
|---|
| Biochemical Properties | It has the ability to interact with purine rich GA repeats.Heterotetramer of two alpha and two beta subunits. The C-terminal is necessary for the formation of a heterotetrameric GABP-alpha-2/beta-2 complex, and also facilitates homotypic dimerization.Interacts with ADGRB2.Contains nuclear localization sequence (NLS, aa 243–319) for nuclear entry. |
|---|
| PTMs | Phosphorylation on Ser |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q0V8G2|GABP2_BOVIN GA-binding protein subunit beta-2 OS=Bos taurus OX=9913 GN=GABPB2 PE=2 SV=2
MSLVDLGKRLLEAARKGQDDEVRTLMANGAPFTTDWLGTSPLHLAAQYGHYSTAEVLLRA
GVSRDARTKVDRTPLHMAAADGHAHIVELLVRNGADVNAKDMLKMTALHWATEHHHRDVV
ELLIKYGADVHAFSKFDKSAFDIALEKNNAEILVILQEAMQNQVNANPERANPVTMATPF
IFTSGEVVNLASLVSSASTKTTSGDPHASSTVHFSNSTTSVLATLAALAEASAPLSNSHR
ATANSEEIIEGNS*253VDSSIQQVVGSGGQRVITIVTDGIPLGNIQTAIPAGGIGQPFIVTVQ
DGQQVLTVPAGQVAEETVIEEEAEEAEKLPLTKKPRIEEMTNSVEESKEGTERELLQQRL
QEANRRAQEYRHQLLKKEQEAEQYRLRLEAMARQQPNGVDFAMVEEVAEVDAVVVTEREM
EERETEVTGAVGTAEPHTGVSMETVST |
|---|
| Predicted Disorder Regions | (308-447) |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | Lats1 Binds to and Promotes the Phosphorylation of GABPb, Inhibiting the homodimerization and nuclear localization of GABPb. |
|---|
| Linking IDs | |
|---|
| Bibliography | 1.Wu H, Xiao Y, Zhang S, Ji S, Wei L, Fan F, Geng J, Tian J, Sun X, Qin F, Jin C, Lin J, Yin ZY, Zhang T, Luo L, Li Y, Song S, Lin SC, Deng X, Camargo F, Avruch J, Chen L, Zhou D. The Ets transcription factor GABP is a component of the hippo pathway essential for growth and antioxidant defense. Cell Rep. 2013 May 30;3(5):1663-77. doi: 10.1016/j.celrep.2013.04.020. Epub 2013 May 16. PMID: 23684612; PMCID: PMC3855275. 2.Bovine Genome Sequencing and Analysis Consortium, Elsik, C. G., Tellam, R. L., Worley, K. C., Gibbs, R. A., Muzny, D. M., Weinstock, G. M., Adelson, D. L., Eichler, E. E., Elnitski, L., Guigó, R., Hamernik, D. L., Kappes, S. M., Lewin, H. A., Lynn, D. J., Nicholas, F. W., Reymond, A., Rijnkels, M., Skow, L. C., Zdobnov, E. M., … Zhao, F. Q. (2009). The genome sequence of taurine cattle: a window to ruminant biology and evolution. Science (New York, N.Y.), 324(5926), 522–528. https://doi.org/10.1126/science.1169588 |
|---|
