Primary Information | |
|---|---|
| BoMiProt ID | Bomi5408 |
| Protein Name | Ectodysplasin-A/Ectodermal dysplasia protein Ectodysplasin-1/Ectodermal dysplasia protein Ectodysplasin-1 |
| Organism | Bos taurus |
| Uniprot ID | Q9BEG5 |
| Milk Fraction | Whey |
| Ref Sequence ID | NP_001075212.1 |
| Aminoacid Length | 391 |
| Molecular Weight | 41567 |
| FASTA Sequence | Download |
| Gene Name | EDA |
| Gene ID | 616179 |
| Protein Existence Status | reviewed |
Secondary Information | |
| Protein Function | induction, morphogenesis and/or maintenance of skin-derived structures such as teeth, hair, sweat glands and several other glands.Deficiencies in the EDA - EDA receptor (EDAR) signalling pathway cause hypohidrotic ectodermal dysplasia (HED). |
| Biochemical Properties | EDA is a 391 amino acid residues-long membrane protein with a short intracellular domain, a transmembrane domain, a stalk region of uncharacterized function, a consensus furin cleavage sequence responsible for proteolytic processing of EDA, a short positively-charged sequence required for interactions with heparan-sulfate proteoglycans, a bi-partite collagen-like domain and a 150 amino acid residues-long C-terminal TNF homology domain (THD) responsible for receptor binding.EDA isoforms (up to nine in mouse keratinocytes), of which only the longest two, EDA1 and EDA2, contain the THD, interact with receptors and are known to be biologically active. EDA1 and EDA2 differ by two amino acid residues in the THD (Glu308 and Val309) as a result of differential usage of a splice donor site at the end of exon 7. |
| Significance in milk | role in the development of skin,hair,teeth and sweat glands |
| PTMs | N-glycosylated on Arg |
| Additional Comments | EDAR agonists may serve to treat certain forms of ectodermal dysplasia. |
| Linking IDs | Bomi5408 |
| Bibliography | Kowalczyk-Quintas C, Schneider P. Ectodysplasin A (EDA) - EDA receptor signalling and its pharmacological modulation. Cytokine Growth Factor Rev. 2014 Apr;25(2):195-203. doi: 10.1016/j.cytogfr.2014.01.004. Epub 2014 Jan 23. PMID: 24508088. |
| Protein Function | induction, morphogenesis and/or maintenance of skin-derived structures such as teeth, hair, sweat glands and several other glands.Deficiencies in the EDA - EDA receptor (EDAR) signalling pathway cause hypohidrotic ectodermal dysplasia (HED). |
| Biochemical Properties | EDA is a 391 amino acid residues-long membrane protein with a short intracellular domain, a transmembrane domain, a stalk region of uncharacterized function, a consensus furin cleavage sequence responsible for proteolytic processing of EDA, a short positively-charged sequence required for interactions with heparan-sulfate proteoglycans, a bi-partite collagen-like domain and a 150 amino acid residues-long C-terminal TNF homology domain (THD) responsible for receptor binding.EDA isoforms (up to nine in mouse keratinocytes), of which only the longest two, EDA1 and EDA2, contain the THD, interact with receptors and are known to be biologically active. EDA1 and EDA2 differ by two amino acid residues in the THD (Glu308 and Val309) as a result of differential usage of a splice donor site at the end of exon 7. |
| Significance in milk | role in the development of skin,hair,teeth and sweat glands |
| PTMs | N-glycosylated on Arg |
| Site(s) of PTM(s) N-glycosylation, O-glycosylation, Phosphorylation | >sp|Q9BEG5|EDA_BOVIN Ectodysplasin-A OS=Bos taurus OX=9913 GN=EDA PE=3 SV=2 MGYPEVERREPLPAAAPRERGSQGCGCRGAPARAGEGNSCRLFLGFFGLSLALHLLTLCC YLELRSELRRERGAESRFSGPGTPGTSGTLSSPGGLDPNGPITRHFGQRSPQQQPLEPGE TTLPPDSQDGHQMALVNFFIPKEKSYSEEESRRVRRNKRSKSSEGADGPVKNKKKGKKAG PPGPNGPPGPPGPPGPQGPPGIPGIPGIPGTTVMGPPGPPGPPGPQGPPGLQGPSGAADK AGTRENQPAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGT YFIYSQVEVYYIN*313FTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKI AVKMVHADISIN*372MSKHTTFFGAIRLGEAPAS |
| Predicted Disorder Regions | 2 disordered segments; (1-35), (71-248) |
| DisProt Annotation | |
| TM Helix Prediction | 1TMH; (42-64) |
| Additional Comments | EDAR agonists may serve to treat certain forms of ectodermal dysplasia. |
| Linking IDs | |
| Bibliography | Kowalczyk-Quintas C, Schneider P. Ectodysplasin A (EDA) - EDA receptor signalling and its pharmacological modulation. Cytokine Growth Factor Rev. 2014 Apr;25(2):195-203. doi: 10.1016/j.cytogfr.2014.01.004. Epub 2014 Jan 23. PMID: 24508088. |