Primary Information |
|---|
| BoMiProt ID | Bomi4916 |
|---|
| Protein Name | C-terminal-binding protein 2/CtBP2 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q0VCQ1 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_783643.1 |
|---|
| Aminoacid Length | 445 |
|---|
| Molecular Weight | 48947 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | CTBP2 |
|---|
| Gene ID | 281730 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | functions as a metabolic sensor in transcriptional corepressor complex.Maintains mitochondrial activities.Since CtBP2 lacks a DNA-binding domain, it is postulated that CtBP2 regulates transcription through binding to transcription factors bound to genomic regions.CtBP is a transcriptional corepressor of Bax gene promoter.Through a structural pocket called Rossmann fold domain,CtBPs can accommodate NADH/NAD+ with preferential binding affinity for NADH and serve as redox-sensing transcriptional corepressors. only CtBP2 has a nuclear localization signal localized in its N-terminal region. They switch off their target genes by binding to sequence-specific DNA-binding proteins that carry a short motif Proline-Isoleucine-Aspartate-Leucine-Serine (the PIDLS motif) and then recruit histone modifiers like Histone deacetylases and methylases.CtBP2 forms dimers and multimers upon activation. |
|---|
| Biochemical Properties | belongs to a family of 2-hydroxyacid dehydrogenases.Senses metabolic changes by differentially binding to NADH and controls the transcription of downstream genes through monomer–dimer transition. |
|---|
| PTMs | Methylation and Phosphorylation |
|---|
| Additional Comments | Ctbp-knockout cells are more sensitive to apoptosis by glucose deprivation |
|---|
| Linking IDs | Bomi4916 |
|---|
| Bibliography | 1.Kim JH, Youn HD. C-terminal binding protein maintains mitochondrial activities. Cell Death Differ. 2009 Apr;16(4):584-92. doi: 10.1038/cdd.2008.186. Epub 2009 Jan 9. PMID: 19136938. 2.Sekiya, M., Kainoh, K., Sugasawa, T. et al. The transcriptional corepressor CtBP2 serves as a metabolite sensor orchestrating hepatic glucose and lipid homeostasis. Nat Commun 12, 6315 (2021). https://doi.org/10.1038/s41467-021-26638-5 |
|---|
| Protein Function | functions as a metabolic sensor in transcriptional corepressor complex.Maintains mitochondrial activities.Since CtBP2 lacks a DNA-binding domain, it is postulated that CtBP2 regulates transcription through binding to transcription factors bound to genomic regions.CtBP is a transcriptional corepressor of Bax gene promoter.Through a structural pocket called Rossmann fold domain,CtBPs can accommodate NADH/NAD+ with preferential binding affinity for NADH and serve as redox-sensing transcriptional corepressors. only CtBP2 has a nuclear localization signal localized in its N-terminal region. They switch off their target genes by binding to sequence-specific DNA-binding proteins that carry a short motif Proline-Isoleucine-Aspartate-Leucine-Serine (the PIDLS motif) and then recruit histone modifiers like Histone deacetylases and methylases.CtBP2 forms dimers and multimers upon activation. |
|---|
| Biochemical Properties | belongs to a family of 2-hydroxyacid dehydrogenases.Senses metabolic changes by differentially binding to NADH and controls the transcription of downstream genes through monomer–dimer transition. |
|---|
| PTMs | Methylation and Phosphorylation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q0VCQ1|CTBP2_BOVIN C-terminal-binding protein 2 OS=Bos taurus OX=9913 GN=CTBP2 PE=1 SV=1
MALVDKHKVKRQRLDRICEGIRPQIMNGPLHPRPLVALLDGRDCTVEMPILKDLATVAFC
DAQSTQEIHEKVLNEAVGAMMYHTITLTREDLEKFKALRVIVRIGSGYDNVDIKAAGELG
IAVCNIPSAAVEETADSTICHILNLYRRNTWLYQALREGTRVQSVEQIREVASGAARIRG
ETLGLIGFGRTGQAVAVRAKAFGFSVLFYDPYLQDGTERSLGVQRVYTLQDLLYQSDCVS
LHCNLNEHNHHLINDFTIKQMRQGAFLVNAARGGLVDEKALAQALKEGRIRGAALDVHES
EPFSFAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAITGRIPESLRNCVNKE
FFVTTAPWSVIDQQAIHPELNGATYRYPPGIVGVAPGGLPAAMEGIIPGGIPVTHNLPTV
AHPSQAPS*428PNQPTKHGDNREHPNEQ
|
|---|
| Predicted Disorder Regions | 1-15, 400-445 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Additional Comments | Ctbp-knockout cells are more sensitive to apoptosis by glucose deprivation |
|---|
| Linking IDs | |
|---|
| Bibliography | 1.Kim JH, Youn HD. C-terminal binding protein maintains mitochondrial activities. Cell Death Differ. 2009 Apr;16(4):584-92. doi: 10.1038/cdd.2008.186. Epub 2009 Jan 9. PMID: 19136938. 2.Sekiya, M., Kainoh, K., Sugasawa, T. et al. The transcriptional corepressor CtBP2 serves as a metabolite sensor orchestrating hepatic glucose and lipid homeostasis. Nat Commun 12, 6315 (2021). https://doi.org/10.1038/s41467-021-26638-5 |
|---|
