Search by BoMiProt ID - Bomi4916


Primary Information

BoMiProt ID Bomi4916
Protein Name C-terminal-binding protein 2/CtBP2
Organism Bos taurus
Uniprot IDQ0VCQ1
Milk FractionWhey
Ref Sequence ID NP_783643.1
Aminoacid Length 445
Molecular Weight 48947
FASTA Sequence Download
Gene Name CTBP2
Gene ID 281730
Protein Existence Status reviewed

Secondary Information

Protein Function functions as a metabolic sensor in transcriptional corepressor complex.Maintains mitochondrial activities.Since CtBP2 lacks a DNA-binding domain, it is postulated that CtBP2 regulates transcription through binding to transcription factors bound to genomic regions.CtBP is a transcriptional corepressor of Bax gene promoter.Through a structural pocket called Rossmann fold domain,CtBPs can accommodate NADH/NAD+ with preferential binding affinity for NADH and serve as redox-sensing transcriptional corepressors. only CtBP2 has a nuclear localization signal localized in its N-terminal region. They switch off their target genes by binding to sequence-specific DNA-binding proteins that carry a short motif Proline-Isoleucine-Aspartate-Leucine-Serine (the PIDLS motif) and then recruit histone modifiers like Histone deacetylases and methylases.CtBP2 forms dimers and multimers upon activation.
Biochemical Properties belongs to a family of 2-hydroxyacid dehydrogenases.Senses metabolic changes by differentially binding to NADH and controls the transcription of downstream genes through monomer–dimer transition.
PTMs Methylation and Phosphorylation
Additional Comments Ctbp-knockout cells are more sensitive to apoptosis by glucose deprivation
Linking IDs Bomi4916
Bibliography 1.Kim JH, Youn HD. C-terminal binding protein maintains mitochondrial activities. Cell Death Differ. 2009 Apr;16(4):584-92. doi: 10.1038/cdd.2008.186. Epub 2009 Jan 9. PMID: 19136938. 2.Sekiya, M., Kainoh, K., Sugasawa, T. et al. The transcriptional corepressor CtBP2 serves as a metabolite sensor orchestrating hepatic glucose and lipid homeostasis. Nat Commun 12, 6315 (2021). https://doi.org/10.1038/s41467-021-26638-5
Protein Function functions as a metabolic sensor in transcriptional corepressor complex.Maintains mitochondrial activities.Since CtBP2 lacks a DNA-binding domain, it is postulated that CtBP2 regulates transcription through binding to transcription factors bound to genomic regions.CtBP is a transcriptional corepressor of Bax gene promoter.Through a structural pocket called Rossmann fold domain,CtBPs can accommodate NADH/NAD+ with preferential binding affinity for NADH and serve as redox-sensing transcriptional corepressors. only CtBP2 has a nuclear localization signal localized in its N-terminal region. They switch off their target genes by binding to sequence-specific DNA-binding proteins that carry a short motif Proline-Isoleucine-Aspartate-Leucine-Serine (the PIDLS motif) and then recruit histone modifiers like Histone deacetylases and methylases.CtBP2 forms dimers and multimers upon activation.
Biochemical Properties belongs to a family of 2-hydroxyacid dehydrogenases.Senses metabolic changes by differentially binding to NADH and controls the transcription of downstream genes through monomer–dimer transition.
PTMs Methylation and Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q0VCQ1|CTBP2_BOVIN C-terminal-binding protein 2 OS=Bos taurus OX=9913 GN=CTBP2 PE=1 SV=1 MALVDKHKVKRQRLDRICEGIRPQIMNGPLHPRPLVALLDGRDCTVEMPILKDLATVAFC DAQSTQEIHEKVLNEAVGAMMYHTITLTREDLEKFKALRVIVRIGSGYDNVDIKAAGELG IAVCNIPSAAVEETADSTICHILNLYRRNTWLYQALREGTRVQSVEQIREVASGAARIRG ETLGLIGFGRTGQAVAVRAKAFGFSVLFYDPYLQDGTERSLGVQRVYTLQDLLYQSDCVS LHCNLNEHNHHLINDFTIKQMRQGAFLVNAARGGLVDEKALAQALKEGRIRGAALDVHES EPFSFAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAITGRIPESLRNCVNKE FFVTTAPWSVIDQQAIHPELNGATYRYPPGIVGVAPGGLPAAMEGIIPGGIPVTHNLPTV AHPSQAPS*428PNQPTKHGDNREHPNEQ
Predicted Disorder Regions 1-15, 400-445
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments Ctbp-knockout cells are more sensitive to apoptosis by glucose deprivation
Linking IDs
Bibliography 1.Kim JH, Youn HD. C-terminal binding protein maintains mitochondrial activities. Cell Death Differ. 2009 Apr;16(4):584-92. doi: 10.1038/cdd.2008.186. Epub 2009 Jan 9. PMID: 19136938. 2.Sekiya, M., Kainoh, K., Sugasawa, T. et al. The transcriptional corepressor CtBP2 serves as a metabolite sensor orchestrating hepatic glucose and lipid homeostasis. Nat Commun 12, 6315 (2021). https://doi.org/10.1038/s41467-021-26638-5