Primary Information |
|---|
| BoMiProt ID | Bomi4411 |
|---|
| Protein Name | Calcium-activated potassium channel subunit alpha-1/BK channel/Maxi K channel |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q28204 |
|---|
| Milk Fraction | Exosomes |
|---|
| Ref Sequence ID | NP_777105.1 |
|---|
| Aminoacid Length | 1166 |
|---|
| Molecular Weight | 130063 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | KCNMA1 |
|---|
| Gene ID | 282573 |
|---|
| Protein Existence Status | Reviewed |
|---|
Secondary Information |
|---|
| Presence in other biological fluids/tissue/cells | myometrium |
|---|
| Protein Function | Potassium channel activated by both membrane depolarization or increase in cytosolic Ca2+ that mediates export of K+. It is also activated by concentration of cytosolic Mg2+. Its activation dampens the excitatory events that elevate the cytosolic Ca2+ concentration and/or depolarize the cell membrane.Plays a key role in controlling excitability in a number of systems, such as regulation of the contraction of smooth muscle, the tuning of hair cells in the cochlea, regulation of transmitter release, and innate immunity. |
|---|
| Biochemical Properties | BK channel is Tetrameric strcucture. Activated by changed electric potential or increased intracellular calcium ions |
|---|
| PTMs | Phosphorylation at Ser/Thr,Palmitoylation |
|---|
| Significance of PTMs | Palmitoylation by ZDHHC22 and ZDHHC23 within the intracellular linker between the S0 and S1 transmembrane domains regulates localization to the plasma membrane. Isoform 1 and isoform 2 are stimulated by PKG, but not by PKA. In contrast, isoform 3 is exclusively stimulated by PKA. In smooth muscles, phosphorylation affects its activity. |
|---|
| Linking IDs | Bomi4411 |
|---|
| Bibliography | 1.Zhou XB, Arntz C, Kamm S, Motejlek K, Sausbier U, Wang GX, Ruth P, Korth M. A molecular switch for specific stimulation of the BKCa channel by cGMP and cAMP kinase. J Biol Chem. 2001 Nov 16;276(46):43239-45. doi: 10.1074/jbc.M104202200. Epub 2001 Aug 20. PMID: 11514553. 2. |
|---|
| Presence in other biological fluids/tissue/cells | myometrium |
|---|
| Protein Function | Potassium channel activated by both membrane depolarization or increase in cytosolic Ca2+ that mediates export of K+. It is also activated by concentration of cytosolic Mg2+. Its activation dampens the excitatory events that elevate the cytosolic Ca2+ concentration and/or depolarize the cell membrane.Plays a key role in controlling excitability in a number of systems, such as regulation of the contraction of smooth muscle, the tuning of hair cells in the cochlea, regulation of transmitter release, and innate immunity. |
|---|
| Biochemical Properties | BK channel is Tetrameric strcucture. Activated by changed electric potential or increased intracellular calcium ions |
|---|
| PTMs | Phosphorylation at Ser/Thr,Palmitoylation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q28204|KCMA1_BOVIN Calcium-activated potassium channel subunit alpha-1 OS=Bos taurus OX=9913 GN=KCNMA1 PE=1 SV=2
MANGGGGGGGGGGGSSLRMSSNIHANHLSLDASSSSSSSSSSSSSSSSVHEPKMDALIIP
VTMEVPCDSRGQRMWWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCGGKTKEAQKIN
NGSSQADGTLKPVDEKEET*139VAAEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGAL
VIYFIDSSNPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDF
FTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWL
TAAGFIHLVENSGDPWENFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFF
ILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKD
RDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILAN
KYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLA
ELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEEDTWQKYYLEGVSNEMYTEYLSSAFVG
LSFPTVCELCFVKLKLLMIAIEYKSANRESRILINPGNHLKIQEGTLGFFIASDAKEVKR
AFFYCKACHDDITDPKRIKKCGCKRLEDEQPST*693LS*695PKKKQRNGGMRNS*708PSSS*712PKLMRHDPLLIPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVVVCIFGDV
SSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRA
DLRAVNINLCDMCVILSANQNNIDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFT*900
PPGMDRSS*908PDNS*912PVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQ
PFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQ
TLANRDRCRVAQLALLDGPFADLGDGGCYGDLFCKALKTYNMLCFGIYRLRDAHLSTPSQ
CTKRYVITNPPYEFELVPTDLIFCLMQFDHNAGQSRASLSHSSHSSQSSSKKSSSVHSIP
STANRQNRPKS*1151RES*1154RDKQKYVQEERL
|
|---|
| Predicted Disorder Regions | 1-50, 702-710, 897-915, 1116-1163 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | 6TMHs ; (74-96),(167-185),(204-222),(288-306),(325-343),(350-372) |
|---|
| Significance of PTMs | Palmitoylation by ZDHHC22 and ZDHHC23 within the intracellular linker between the S0 and S1 transmembrane domains regulates localization to the plasma membrane. Isoform 1 and isoform 2 are stimulated by PKG, but not by PKA. In contrast, isoform 3 is exclusively stimulated by PKA. In smooth muscles, phosphorylation affects its activity. |
|---|
| Linking IDs | |
|---|
| Bibliography | 1.Zhou XB, Arntz C, Kamm S, Motejlek K, Sausbier U, Wang GX, Ruth P, Korth M. A molecular switch for specific stimulation of the BKCa channel by cGMP and cAMP kinase. J Biol Chem. 2001 Nov 16;276(46):43239-45. doi: 10.1074/jbc.M104202200. Epub 2001 Aug 20. PMID: 11514553. 2. |
|---|
