Primary Information | |
---|---|
BoMiProt ID | Bomi4255 |
Protein Name | Beta-arrestin-2/Arrestin beta-2/Arrestin-3 |
Organism | Bos taurus |
Uniprot ID | P32120 |
Milk Fraction | Whey |
Aminoacid Length | 420 |
Molecular Weight | 47224 |
FASTA Sequence | Download |
Gene Name | ARRB2 |
Protein Existence Status | Reviewed |
Secondary Information | |
Protein Function | β-arrestin 2 regulates multiple cellular events through the G protein-coupled receptor (GPCR) signaling pathways.It also promotes virus-induced production of IFN-β and clearance of viruses in macrophages. β-arrestin 2 interacts with cyclic GMP-AMP synthase (cGAS) and increases the binding of dsDNA to cGAS to enhance cyclic GMP-AMP (cGAMP) production and the downstream stimulator of interferon genes (STING) and innate immune responses. |
PTMs | Phosphorylation at Thr-382,Hydroxylation,Ubl conjugation |
Significance of PTMs | The ubiquitination status appears to regulate the formation and trafficking of beta-arrestin-GPCR complexes and signaling. Ubiquitination appears to occur GPCR-specific.Hydroxylation by PHD2 modulates the rate of internalization by slowing down recruitment to the plasma membrane and inhibiting subsequent co-internalization with class A receptors. |
PDB ID | 3P2D, 5TV1, |
Additional Comments | β-arrestin 2 overexpression significantly enhanced the interaction between Flag-tagged cGAS and HA-tagged cGAS. |
Linking IDs | Bomi4255 |
Bibliography | 1.Zhang Y, Li M, Li L, Qian G, Wang Y, Chen Z, Liu J, Fang C, Huang F, Guo D, Zou Q, Chu Y, Yan D. β-arrestin 2 as an activator of cGAS-STING signaling and target of viral immune evasion. Nat Commun. 2020 Nov 26;11(1):6000. doi: 10.1038/s41467-020-19849-9. PMID: 33243993; PMCID: PMC7691508. 2.Wu J, et al. Cyclic GMP-AMP is an endogenous second messenger in innate immune signaling by cytosolic DNA. Science. 2013;339:826–830. doi: 10.1126/science.1229963. |
Protein Function | β-arrestin 2 regulates multiple cellular events through the G protein-coupled receptor (GPCR) signaling pathways.It also promotes virus-induced production of IFN-β and clearance of viruses in macrophages. β-arrestin 2 interacts with cyclic GMP-AMP synthase (cGAS) and increases the binding of dsDNA to cGAS to enhance cyclic GMP-AMP (cGAMP) production and the downstream stimulator of interferon genes (STING) and innate immune responses. |
PTMs | Phosphorylation at Thr-382,Hydroxylation,Ubl conjugation |
Site(s) of PTM(s) N-glycosylation, O-glycosylation, Phosphorylation | >sp|P32120|ARRB2_BOVIN Beta-arrestin-2 OS=Bos taurus OX=9913 GN=ARRB2 PE=1 SV=1 MGEKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDY*48LKDRKVFVTLTC AFRYGREDLDVLGLSFRKDLFIANYQAFPPTPNPPRPPTRLQERLLRKLGQHAHPFFFTI PQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSLEEKSHKRNSVRLVIRKVQFAPEKPG PQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYA DICLFSTAQYKCPVAQVEQDDQVSPSSTFCKVYTITPLLSNNREKRGLALDGKLKHEDTN LASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIALPRPQS*360 AATHPPTLLPSAVPETDAPVDTNLIEFETNYAT*393DDDIVFEDFARLRLKGLKDEDYDDQFC |
CATH | Matched CATH superfamily 2.60.40.640 2.60.40.840 |
Predicted Disorder Regions | 1-9, 89-104, 177-185, 352-380, 410-420 |
DisProt Annotation | Disorder content 10.7% Term molecular adaptor activity, Fragment 385 - 394 Term disorder, Fragment 350 - 393 |
TM Helix Prediction | No TM helices |
Significance of PTMs | The ubiquitination status appears to regulate the formation and trafficking of beta-arrestin-GPCR complexes and signaling. Ubiquitination appears to occur GPCR-specific.Hydroxylation by PHD2 modulates the rate of internalization by slowing down recruitment to the plasma membrane and inhibiting subsequent co-internalization with class A receptors. |
PDB ID | 3P2D, 5TV1, |
Additional Comments | β-arrestin 2 overexpression significantly enhanced the interaction between Flag-tagged cGAS and HA-tagged cGAS. |
Linking IDs | |
Bibliography | 1.Zhang Y, Li M, Li L, Qian G, Wang Y, Chen Z, Liu J, Fang C, Huang F, Guo D, Zou Q, Chu Y, Yan D. β-arrestin 2 as an activator of cGAS-STING signaling and target of viral immune evasion. Nat Commun. 2020 Nov 26;11(1):6000. doi: 10.1038/s41467-020-19849-9. PMID: 33243993; PMCID: PMC7691508. 2.Wu J, et al. Cyclic GMP-AMP is an endogenous second messenger in innate immune signaling by cytosolic DNA. Science. 2013;339:826–830. doi: 10.1126/science.1229963. |