Search by BoMiProt ID - Bomi4255


Primary Information

BoMiProt ID Bomi4255
Protein Name Beta-arrestin-2/Arrestin beta-2/Arrestin-3
Organism Bos taurus
Uniprot IDP32120
Milk FractionWhey
Aminoacid Length 420
Molecular Weight 47224
FASTA Sequence Download
Gene Name ARRB2
Protein Existence Status Reviewed

Secondary Information

Protein Function β-arrestin 2 regulates multiple cellular events through the G protein-coupled receptor (GPCR) signaling pathways.It also promotes virus-induced production of IFN-β and clearance of viruses in macrophages. β-arrestin 2 interacts with cyclic GMP-AMP synthase (cGAS) and increases the binding of dsDNA to cGAS to enhance cyclic GMP-AMP (cGAMP) production and the downstream stimulator of interferon genes (STING) and innate immune responses. 
PTMs Phosphorylation at Thr-382,Hydroxylation,Ubl conjugation
Significance of PTMs The ubiquitination status appears to regulate the formation and trafficking of beta-arrestin-GPCR complexes and signaling. Ubiquitination appears to occur GPCR-specific.Hydroxylation by PHD2 modulates the rate of internalization by slowing down recruitment to the plasma membrane and inhibiting subsequent co-internalization with class A receptors.
PDB ID 3P2D, 5TV1,
Additional Comments β-arrestin 2 overexpression significantly enhanced the interaction between Flag-tagged cGAS and HA-tagged cGAS.
Linking IDs Bomi4255
Bibliography 1.Zhang Y, Li M, Li L, Qian G, Wang Y, Chen Z, Liu J, Fang C, Huang F, Guo D, Zou Q, Chu Y, Yan D. β-arrestin 2 as an activator of cGAS-STING signaling and target of viral immune evasion. Nat Commun. 2020 Nov 26;11(1):6000. doi: 10.1038/s41467-020-19849-9. PMID: 33243993; PMCID: PMC7691508. 2.Wu J, et al. Cyclic GMP-AMP is an endogenous second messenger in innate immune signaling by cytosolic DNA. Science. 2013;339:826–830. doi: 10.1126/science.1229963.
Protein Function β-arrestin 2 regulates multiple cellular events through the G protein-coupled receptor (GPCR) signaling pathways.It also promotes virus-induced production of IFN-β and clearance of viruses in macrophages. β-arrestin 2 interacts with cyclic GMP-AMP synthase (cGAS) and increases the binding of dsDNA to cGAS to enhance cyclic GMP-AMP (cGAMP) production and the downstream stimulator of interferon genes (STING) and innate immune responses. 
PTMs Phosphorylation at Thr-382,Hydroxylation,Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P32120|ARRB2_BOVIN Beta-arrestin-2 OS=Bos taurus OX=9913 GN=ARRB2 PE=1 SV=1 MGEKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDY*48LKDRKVFVTLTC AFRYGREDLDVLGLSFRKDLFIANYQAFPPTPNPPRPPTRLQERLLRKLGQHAHPFFFTI PQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSLEEKSHKRNSVRLVIRKVQFAPEKPG PQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYA DICLFSTAQYKCPVAQVEQDDQVSPSSTFCKVYTITPLLSNNREKRGLALDGKLKHEDTN LASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIALPRPQS*360 AATHPPTLLPSAVPETDAPVDTNLIEFETNYAT*393DDDIVFEDFARLRLKGLKDEDYDDQFC
CATH Matched CATH superfamily
2.60.40.640
2.60.40.840
Predicted Disorder Regions 1-9, 89-104, 177-185, 352-380, 410-420
DisProt Annotation Disorder content 10.7%
Term molecular adaptor activity, Fragment 385 - 394
Term disorder, Fragment 350 - 393
TM Helix Prediction No TM helices
Significance of PTMs The ubiquitination status appears to regulate the formation and trafficking of beta-arrestin-GPCR complexes and signaling. Ubiquitination appears to occur GPCR-specific.Hydroxylation by PHD2 modulates the rate of internalization by slowing down recruitment to the plasma membrane and inhibiting subsequent co-internalization with class A receptors.
PDB ID 3P2D, 5TV1,
Additional Comments β-arrestin 2 overexpression significantly enhanced the interaction between Flag-tagged cGAS and HA-tagged cGAS.
Linking IDs
Bibliography 1.Zhang Y, Li M, Li L, Qian G, Wang Y, Chen Z, Liu J, Fang C, Huang F, Guo D, Zou Q, Chu Y, Yan D. β-arrestin 2 as an activator of cGAS-STING signaling and target of viral immune evasion. Nat Commun. 2020 Nov 26;11(1):6000. doi: 10.1038/s41467-020-19849-9. PMID: 33243993; PMCID: PMC7691508. 2.Wu J, et al. Cyclic GMP-AMP is an endogenous second messenger in innate immune signaling by cytosolic DNA. Science. 2013;339:826–830. doi: 10.1126/science.1229963.