Primary Information |
|---|
| BoMiProt ID | Bomi9960 |
|---|
| Protein Name | Transformer-2 protein homolog beta/TRA-2 beta |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q3ZBT6 |
|---|
| Milk Fraction | whey |
|---|
| Ref Sequence ID | NP_001029948.1 |
|---|
| Aminoacid Length | 288 |
|---|
| Molecular Weight | 33666 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | TRA2B/SFRS10 |
|---|
| Gene ID | 615156 |
|---|
| Protein Existence Status | Reviewed |
|---|
Secondary Information |
|---|
| Protein Function | It can either activate or suppress exon inclusion. It acts along with RBMX to promote exon 7 inclusion of the survival motor neuron SMN2. It also activates the splicing of MAPT/Tau exon 10. |
|---|
| Biochemical Properties | Binds to the AG-rich SE2 domain in the SMN exon 7 RNA |
|---|
| PTMs | Acetylation, Methykation, Phsophorylation and Ubiquitinylation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q3ZBT6|TRA2B_BOVIN Transformer-2 protein homolog beta OS=Bos taurus OX=9913 GN=TRA2B PE=2 SV=1
MS*2DS*4GEQNYGERES*14RSASRSGSAHGSGKS*29ARHT*33PARSRSKEDSRRSRSKSRSRSESRSRS
RRSSRRHYTRSRSRSRSHRRSRS*83RS*85YS*87RDYRRRHS*95HS*97HS*99PMST*103RRRHVGNRANPDPNCCLGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERAN
GMELDGRRIRVDFSITKRPHT*201PT*203PGIYMGRPTYGS*215SRRRDYYDRGYDRGYDDRDYYS*237RSYRGGGGGGGGWRAAQDRDQIYRRRSPSPYYSRGGYRSRSRSRSYSPRRY
|
|---|
| Predicted Disorder Regions | (1-114), (197-223), (262-288) |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | Phosphorylated in the RS domains.Phosphorylation of Tra2b increases its interaction with the putative spermatogenic splicing factor RBM and also affects its localization and function.Tra2b also appears to be relatively hypo-phosphorylated in testis.Tra2b up-regulation in testis appears to be solely
responsible for HipK3-T exon inclusion.Phosphorylation of Tra2b inhibits alternative splicing and binding of its own message. |
|---|
| Bibliography | 1.Venables JP, Bourgeois CF, Dalgliesh C, Kister L, Stevenin J, Elliott DJ. Up-regulation of the ubiquitous alternative splicing factor Tra2beta causes inclusion of a germ cell-specific exon. Hum Mol Genet. 2005 Aug 15;14(16):2289-303. doi: 10.1093/hmg/ddi233. Epub 2005 Jul 6. PMID: 16000324. 2.Paudel, D., Ouyang, Y., Huang, Q., Zhou, W., Wang, J., Poorekhorsandi, M. E., Dhakal, B., & Tong, X. (2019). Expression of TRA2B in endometrial carcinoma and its regulatory roles in endometrial carcinoma cells. Oncology letters, 18(3), 2455–2463. https://doi.org/10.3892/ol.2019.10553 |
|---|
