Primary Information |
---|
BoMiProt ID | Bomi9949 |
---|
Protein Name | Transcription initiation factor TFIID subunit 8/TBP-associated factor 8 |
---|
Organism | Bos taurus |
---|
Uniprot ID | A7MAZ4 |
---|
Milk Fraction | Whey |
---|
Ref Sequence ID | NP_001094670.1 |
---|
Aminoacid Length | 310 |
---|
Molecular Weight | 34227 |
---|
FASTA Sequence |
Download |
---|
Gene Name | TAF8 |
---|
Gene ID | 539938 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | helps in the assembly of TFIID complex formation.transcription factor TFIID is a cornerstone of RNA polymerase II transcription initiation in eukaryotic cells. |
---|
Biochemical Properties | 310 amino acid protein harboring a histone fold domain (HFD) at its N-terminal end, which interacts with the HFD of TAF10, to form a noncanonical histone fold pair arrangement in TFIID.TAF8 also interacts with TAF2 and TAF2-TAF8-TAF10 subcomplex assembles in the cytoplasm. |
---|
PTMs | Acetylation, Phosphorylation |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|A7MAZ4|TAF8_BOVIN Transcription initiation factor TFIID subunit 8 OS=Bos taurus OX=9913 GN=TAF8 PE=2 SV=1
MADAAATAGAAGSGTRSGSKQSTNPADNYHLARRRTLQVVVSSLLTEAGFESAEKASVET
LTEMLQSYISEIGRSAKSYCEHTARTQPTLSDIVVTLVEMGFNVDTLPAYAKRSQRMVIT
APPVTNQPVT*130PKALTAGQNRPHPPHIPSHFPEFPDPHTYIKTPTYREPVSDYQVLREKAA
SQRRDVERALTRFMAKTGETQSLFKDDVSTFPLIAARPFTIPYLTALLPSELEMQQMEET
DSSEQDEQTDTENLPLHISPDDSGAEKENTS*271VLQQNPSLSGSRNGEESIIDNPYLRPVKK
PKIRRKKSLS
|
---|
Predicted Disorder Regions | 1-34, 115-205, 224-310 |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Bibliography | Scheer E, Luo J, Bernardini A, Ruffenach F, Garnier JM, Kolb-Cheynel I, Gupta K, Berger I, Ranish J, Tora L. TAF8 regions important for TFIID lobe B assembly or for TAF2 interactions are required for embryonic stem cell survival. J Biol Chem. 2021 Nov;297(5):101288. doi: 10.1016/j.jbc.2021.101288. Epub 2021 Oct 9. PMID: 34634302; PMCID: PMC8564675. |