Primary Information |
|---|
| BoMiProt ID | Bomi9944 |
|---|
| Protein Name | Transcription factor NF-E2 45 kDa subunit/Leucine zipper protein NF-E2/Nuclear factor, erythroid-derived 2 45 kDa subunit/p45 NF-E2 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q5EAD3 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001014923.1 |
|---|
| Aminoacid Length | 374 |
|---|
| Molecular Weight | 41390 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | NFE2 |
|---|
| Gene ID | 514006 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | This protein could be a target for pharmacologic interventions in patients with excess red cell production due to polycythemia vera. |
|---|
| Biochemical Properties | NF-E2 belongs to the basic-leucine zipper family of dimeric transcription factors. It consists of a widely expressed 18 kDa subunit, related to chicken Maf proteins, and a tissue-restricted 45 kDa subunit, which contains a cnc domain. |
|---|
| PTMs | Isopeptide bond formation, Phosphorylation at Ser, Ubl conjugation,SUMOylation,Ubiquitinated mainly by 'Lys63'-linked ubiquitin. |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q5EAD3|NFE2_BOVIN Transcription factor NF-E2 45 kDa subunit OS=Bos taurus OX=9913 GN=NFE2 PE=2 SV=1
MSPCPPQQSRNRVTQLPIPEPGEMELTWQEIMSITELQGLNAPSEPSFEPPAPVPYPGPP
PPPSYCPCSIHSEPGFPLPAPPYELPAPTSHVPDPPYSYGSNMTVPVSKPLTLSGLLSDP
LPDPLALLDIGLSAGPSKPQEDPESDSGLSLNYSDAES*158LELEGTEAGRRRS*171EYVEMYPVE
YPYSLMPNSLTHPNYALPPAETPLALEPSSGPVRAKPTARGEAGSRDERRALAMKIPFPT
DKIVNLPVDDFNELLARYPLTESQLALVRDIRRRGKNKVAAQNCRKRKLETIVQLERELE
RLGSERERLLRARGEADRTLEVMRQQLTDLYRDIFQHLRDEAGNSYSPEDYALHQAADGA
IFLVPRGTKMEATD
|
|---|
| Predicted Disorder Regions | 1-229, 275-293 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | In undifferentiated erythrocytes, phosphorylated by MAPK8 which then leads to ubiquitination and protein degradation.Sumoylation is required for the translocation of nuclear bodies PODs, anchoring to the gene loci,and transactivation of the beta-globin gene.Polyubiquitination of 'Lys63'-linked ubiquitin by ITCH retains NFE2 in the cytoplasm preventing it's transactivation activity. |
|---|
| Additional Comments | Erythroid transcription activator nuclear factor erythroid-derived 2 (NF-E2), composed of a heterodimer of NFE2 and MAFK, possesses transactivation activity on beta-globin. Also forms high affinity heterodimer with MAFG; the interaction promotes erythropoiesis. |
|---|
| Bibliography | 1.Andrews NC. The NF-E2 transcription factor. Int J Biochem Cell Biol. 1998 Apr;30(4):429-32. doi: 10.1016/s1357-2725(97)00135-0. PMID: 9675875. |
|---|
