Primary Information |
|---|
| BoMiProt ID | Bomi9939 |
|---|
| Protein Name | Transcription factor jun-B |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q0VBZ5 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001069124.1 |
|---|
| Aminoacid Length | 347 |
|---|
| Molecular Weight | 35929 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | JUNB |
|---|
| Gene ID | 514246 |
|---|
| Protein Existence Status | Reviewed |
|---|
Secondary Information |
|---|
| Protein Function | Maintain Organ-Specific Treg Proportions.and maintain Treg homeostasis. JunB is a transcriptional activator of various cytokine genes, such as IL-2, IL-4, and IL-10.JunB is another member of the AP-1 family of transcription factor. contain basic leucine zipper (bZIP) domains |
|---|
| Significance in milk | Control milk protein genes expression. |
|---|
| PTMs | Sumoylation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q0VBZ5|JUNB_BOVIN Transcription factor JunB OS=Bos taurus OX=9913 GN=JUNB PE=2 SV=1
MCTKMEQPFYHDDSYAAAGYGRTPGGLSLHDYKLLKPSLALNLSDPYRNLKAPGARGPGP
EGNGGGSYFSSQGSDTGASLKLASSELERLIVPNSNGVITTT*102PT*104PPGQYFYPRGGGS*117GGG
AGGAGGGVTEEQEGFADGFVKALDDLHKMNHVTPPNVSLGASGGPPAGPGGVYAGPEPPP
VYTNLSSYSPASAPSGGAGAAVGTGSSYPTATISYLPHAPPFAGGHPAQLGLGRGASAFK
EEPQTVPEARS*251RDAT*255PPVS*259PINMEDQERIKVERKRLRNRLAATKCRKRKLERIARLEDKV
KTLKAENAGLSSTAGLLREQVAQLKQKVMTHVSNGCQLLLGVKGHAF
|
|---|
| Predicted Disorder Regions | 18-26, 46-86, 99-143, 153-192, 218-222, 234-251, 260-268, 279-288 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | JunB sumoylation of JunB regulates its ability to induce cytokine gene transcription and likely plays a critical role in T cell activation.sumoylation is responsible for trans activating IL-2 and IL-4 reporter genes |
|---|
| Bibliography | Garaude J, Farrás R, Bossis G, Charni S, Piechaczyk M, Hipskind RA, Villalba M. SUMOylation regulates the transcriptional activity of JunB in T lymphocytes. J Immunol. 2008 May 1;180(9):5983-90. doi: 10.4049/jimmunol.180.9.5983. PMID: 18424718. |
|---|
