Primary Information |
|---|
| BoMiProt ID | Bomi9924 |
|---|
| Protein Name | Transcription elongation factor A protein 1/Transcription elongation factor S-II protein 1 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q29RL9 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001039390.1 |
|---|
| Aminoacid Length | 301 |
|---|
| Molecular Weight | 33891 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | TCEA1 |
|---|
| Gene ID | 505722 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | This elongation factors help RNA polymerase II to transcribe past blockages due to specific DNA sequences, DNA-binding proteins, and transcription-arresting drugs.required for balance between proliferation and differentiation. |
|---|
| PTMs | Phosphorylation on Ser,Acetylation on Met |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q29RL9|TCEA1_BOVIN Transcription elongation factor A protein 1 OS=Bos taurus OX=9913 GN=TCEA1 PE=2 SV=1
MEDEVIRIAKKMDKMVQKKNAAGALDLLKELKNIPMTLELLQSTRIGMSVNAIRKQS*57TDE
EVTSLAKSLIKSWKKLLDGPS*81TDKDSEEKKKDTAVTS*97QNS*100PEAREESSSSGNMSSRKDET
NARDTYVSSFPRAPSTSDSVRLKCREMLAAALRTGDDYIAIGADEEELGSQIEEAIYQEI
RNTDMKYKNRVRSRISNLKDAKNPNLRKNVLCGNIPPDLFARMTAEEMASDELKEMRKNL
TKEAIREHQMAKTGGTQTDLFTCGKCKKKNCTYTQVQTRSADEPMTTFVVCNECGNRWKF
C
|
|---|
| Predicted Disorder Regions | 8-23, 54-58, 73-139, 155-181, 231-252, 258-263 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Bibliography | 1.Yang T, Cui H, Wen M, Zuber J, Kogan SC, Wei G. TCEA1 regulates the proliferative potential of mouse myeloid cells. Exp Cell Res. 2018 Sep 15;370(2):551-560. doi: 10.1016/j.yexcr.2018.07.020. Epub 2018 Jul 25. PMID: 30009791; PMCID: PMC6816334. 2.Ito T, Doi K, Matsumoto N, Kakihara F, Noiri E, Hasegawa S, Tokunaga K, Sekimizu K. Lack of polymorphisms in the coding region of the highly conserved gene encoding transcription elongationfactor S-II (TCEA1). Drug Discov Ther. 2007 Aug;1(1):9-11. PMID: 22504358. |