Primary Information |
---|
BoMiProt ID | Bomi9917 |
---|
Protein Name | TRAF-interacting protein with FHA domain-containing protein A |
---|
Organism | Bos taurus |
---|
Uniprot ID | A2VDM0 |
---|
Milk Fraction | Whey |
---|
Ref Sequence ID | NP_001075090.1 |
---|
Aminoacid Length | 185 |
---|
Molecular Weight | 21579 |
---|
FASTA Sequence |
Download |
---|
Gene Name | TIFA |
---|
Gene ID | 783855 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | TRAF-interacting protein with forkhead-associated domain (TIFA), an established NF-κB activator in the cytosol, unexpectedly exhibited nuclear translocation and accumulation on damaged chromatin following genotoxic stress. |
---|
Biochemical Properties | TRAF (TNF receptor associated factor)-family proteins, represented by TRAF2 and TRAF6 with a N-terminal RING finger domain, are key intermediates in many NF- B signaling pathways, employing their E3 ligase activity to synthesize a regulatory lysine 63-linked polyubiquitin chain on target proteins |
---|
PTMs | Phosphorylation at Ser and Thr |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|A2VDM0|TIFA_BOVIN TRAF-interacting protein with FHA domain-containing protein A OS=Bos taurus OX=9913 GN=TIFA PE=2 SV=1
MSSFEDADT*9EEMVTCLQMTLYHPGHQRSGIFRSIKFFNREKLPTSEVVKFGRNSHTCNYI
FQDKQVSRVQFSLQVFKKFNSSVVSFEIKNMSKKTSLLVDNKELGYLNKMDLPDKCMIRF
GDYQFLVEKEDGESLEFFEIQFSLSKKPLLQENNWLSQEPIPECGSYSSCLTQNNSPMEV
GENEW
|
---|
Predicted Disorder Regions | 1-7, 162-164, 169-185 |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Significance of PTMs | Phosphorylation at Thr-9 by ALPK1 leads to the formation of an intermolecular binding between the FHA domain and phosphorylated Thr-9, promoting TIFA oligomerization and TIFA-mediated NF-kappa-B activation. |
---|
Additional Comments | TIFA relayed the DNA damage signals by stimulating ubiquitination of NF-κB essential modulator (NEMO), whose sumoylation, phosphorylation, and ubiquitination were critical for NF-κB's response to DNA damage. |
---|
Bibliography | Fu J, Huang D, Yuan F, Xie N, Li Q, Sun X, Zhou X, Li G, Tong T, Zhang Y. TRAF-interacting protein with forkhead-associated domain (TIFA) transduces DNA damage-induced activation of NF-κB. J Biol Chem. 2018 May 11;293(19):7268-7280. doi: 10.1074/jbc.RA117.001684. Epub 2018 Mar 26. PMID: 29581234; PMCID: PMC5950011. |