Primary Information |
|---|
| BoMiProt ID | Bomi9794 |
|---|
| Protein Name | TGF-beta receptor type-1/TGF-beta type I receptor
Transforming growth factor-beta receptor type I/TGF-beta receptor type I/TbetaR-I |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | O46680 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_777046.1 |
|---|
| Aminoacid Length | 499 |
|---|
| Molecular Weight | 55814 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | TGFBR1 |
|---|
| Gene ID | 282382 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | Transforming growth factor (TGF)-β1 is a multifunctional cytokine and its signaling is essential for the maintenance of immune tolerance |
|---|
| Biochemical Properties | TGF-β1 signaling is initiated by binding of TGF-β1 to its heterodimeric transmembrane receptor complex, which is composed of type I (TGF-βRI) and type II (TGF-βRII) receptors. Binding of TGF-β1 results in the phosphorylation and activation of TGF-βRI, which then activates TGF-βRII |
|---|
| Significance in milk | Its presence in breast milk provides the newborn with a variety of bioactive factors protecting against infection and inflammation and is required for immune maturation, organ development and healthy microbial colonization. |
|---|
| PTMs | Phosphorylation at Ser/Thr |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|O46680|TGFR1_BOVIN TGF-beta receptor type-1 OS=Bos taurus OX=9913 GN=TGFBR1 PE=2 SV=1
MEAAAATPRPRLFLLMLAAAATLVPEATPLQCFCHLCTKDN*41FTCVTDGLCFVSVTETTDK
VIHNSMCIAEIDLIPRDRPFVCAPSSKTGSITTTYCCNQDHCNKIELPTVGKPSSGLGPV
ELAAVIAGPVCFVCISLMLMVYICHNRTVIHHRVPNEEDPS*161LDRPFISEGTTLKDLIYDM
T*181T*182S*183GS*185GS*187GLPLLVQRTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVEGMIK
LALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDSATDT
IDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEVARRCSIGGIHEDY
QLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGAARLT
ALRIKKTLSQLSQQEGIKM
|
|---|
| Predicted Disorder Regions | NA |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | 2TMHs; (12-30),(122-144) |
|---|
| Significance of PTMs | Binding of TGF-β1 results in the phosphorylation and activation of TGF-βRI, which then activates TGF-βRII |
|---|
| Additional Comments | TGF-β1 signaling is important for the local immune response in Atopic dermatitis(AD). |
|---|
| Bibliography | 1.Alyoussef A. Blocking TGF-β type 1 receptor partially reversed skin tissue damage in experimentally induced atopic dermatitis in mice. Cytokine. 2018 Jun;106:45-53. doi: 10.1016/j.cyto.2018.02.025. Epub 2018 Mar 14. PMID: 29549723. 2.Brenmoehl J, Ohde D, Wirthgen E, Hoeflich A. Cytokines in milk and the role of TGF-beta. Best Pract Res Clin Endocrinol Metab. 2018 Jan;32(1):47-56. doi: 10.1016/j.beem.2018.01.006. Epub 2018 Feb 2. PMID: 29549959. |