Primary Information |
|---|
| BoMiProt ID | Bomi9724 |
|---|
| Protein Name | T-cell surface glycoprotein CD5/CD_antigen: CD5 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | P19238 |
|---|
| Milk Fraction | Whey,MFGM |
|---|
| Ref Sequence ID | NP_776324.1 |
|---|
| Aminoacid Length | 495 |
|---|
| Molecular Weight | 54367 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | CD5 |
|---|
| Gene ID | 280745 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | May act as a receptor in regulating T-cell proliferation. plays a pivotal role in mediating outcomes of cell survival or apoptosis, and may prevent both autoimmunity and cancer. acts as a negative regulator of TCR signaling in mature T cells. |
|---|
| Biochemical Properties | a type-I transmembrane glycoprotein with an extracellular region composed of three scavenger receptor cysteine-rich (SRCR) domains. |
|---|
| PTMs | Disulfide bond formation, Glycosylation, Phosphorylation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|P19238|CD5_BOVIN T-cell surface glycoprotein CD5 OS=Bos taurus OX=9913 GN=CD5 PE=2 SV=2
MGSQHLPLAALYLLELLVTSCLGGLKVEVQGLTMRLSGSGSRCQGRLEVSN*51GTEWYAVHS
QSWGQLSLYQVAPRQFLKLCQELQCRDPLLLSSSRYFKEVQFQKLIICHGQLGSFSN*117CSL
NRGRQVDSLALICLEPPRTTAPPTTSPPTTTPEPTAPPRFQLVAEPGGLRCAGVVEFYSG
GLGGTIGIEPQNDIKDLGQLICAALQCGSFLKPLPETEEAQTQKPEGQRPLPIRWEIQNP
KCTSLEQCFRKVQPWVGGQALGLICSDFQPKVQSRLVGGSDVCEGSVEVRSGKGQKWDTL
CDDSWAKGTARWEEVCREQQCGN*323VSSYRGLDPSEKTLGGFYCPPGILSRCHKLEEKKSHC
KRVFVTCQN*369SSRAGLGAGAVMSIILALLLLAVLLVVCGPLAYKKVVKKFRQKKQRQWIGP
TGMNQNMSFHRNHTVTVRS*439QVENATASHVENEY*453SQPPRNS*460QISAYPALEGALHRISTQPD
NSS*483DS*485DYELHGAQRL
|
|---|
| Predicted Disorder Regions | 137-157, 215-228, 438-493 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | 1TMH; (380-402) |
|---|
| Significance of PTMs | On cytoplasmic tail,contains four tyrosine residues at position 402, 453, 464, and 486 in human which are considered as phosphorylation sites.In the absence of binding of CD5 with potential ligands, TCR stimulation triggers CD5 phosphorylation on tyrosine residues and its translocation into the immunological synapse, thereby indicating a direct regulation of CD5 by TCR signals. |
|---|
| Bibliography | 1.Domingues, R. G., Lago-Baldaia, I., Pereira-Castro, I., Fachini, J. M., Oliveira, L., Drpic, D., Lopes, N., Henriques, T., Neilson, J. R., Carmo, A. M., & Moreira, A. (2016). CD5 expression is regulated during human T-cell activation by alternative polyadenylation, PTBP1, and miR-204. European journal of immunology, 46(6), 1490–1503. https://doi.org/10.1002/eji.201545663 2.Voisinne G, Gonzalez de Peredo A, Roncagalli R. CD5, an Undercover Regulator of TCR Signaling. Front Immunol. 2018 Dec 7;9:2900. doi: 10.3389/fimmu.2018.02900. PMID: 30581443; PMCID: PMC6292949. |