Primary Information |
|---|
| BoMiProt ID | Bomi9652 |
|---|
| Protein Name | Syndecan-1/CD_antigen: CD138/SYND1 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q08DZ5 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001069392.1 |
|---|
| Aminoacid Length | 311 |
|---|
| Molecular Weight | 32316 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | SDC1 |
|---|
| Gene ID | 529759 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | heparan sulfate proteoglycans.Imp for ell-cell and cell-matrix interactions |
|---|
| Biochemical Properties | integral membrane heparan sulfate proteoglycan,represent the major source of heparan sulfate on the cell surface.share a common construction with an NH2-terminal extracellular domain, an internal hydrophobic membrane-spanning domain, and a short COOH-terminal cytoplasmic domain. |
|---|
| Significance in milk | found in the hypothalamic nuclei that control energy balance, and was associated with maturity-onset obesity. Syndecan-1 gene could be regarded as molecular marker for superior birth weight and body length. |
|---|
| PTMs | Glycoprotein, Hydroxylation,proteolysis |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q08DZ5|SDC1_BOVIN Syndecan-1 OS=Bos taurus OX=9913 GN=SDC1 PE=2 SV=1
MRRAALWLWLCALALRLQPALLHSVAVNMPPEDQDGS*37GDDSDN*43FS*45GS*47GAGALPDITSSHT
PSTWKDLGPVTTTATAPEPTSPDAIAASTTILPTGEQPEGGRAVLLAEVEPGLTAQKEAT
HPPSETTLHPTTHSVSTARATMAPGPATSHPHRDVQPDHHETSAPTGRGRMEPHRPHVEE
GGPPATEKAAEEDPSTQIPVGEGS*204GEQDFTFDLS*214GENAAGAAGEPGSRNGAPEDPEATGA
TGASQGLLDRKEVLGGVIAGGLVGLIFAVCLVGFMLYRMKKKDEGS*286YSLEEPKQANGGAY
QKPTKQEEFYA |
|---|
| Predicted Disorder Regions | 3 disordered segments; (3-232), (238-250), (283-311) |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | 1TMH; (255-277) |
|---|
| Significance of PTMs | After cleavage of the signal peptide, syndecan-1 in humans is 288 amino acids long with a theoretical molecular weight and pI respectively of 30 kDa and 4.5.Heparan sulfate polymerization is initiated on serines 37 (15* [*after signal peptide cleavage]), 45 (23*) and 47 (25*) within the respective amino terminal core protein sequences DGSGD and NFSGSGA. One N-linked glycosylation site is predicted on asparagine 43 (22*; NFSG; NetNGlyc 1.0). NetOGlyc 3.1 reveals 33 potential sites of O-glycosylation - most between between amino acids 68 (46*) and 180 (158*).Heparan sulfate binds fibroblast (FGF), vascular endothelial and hepatocyte growth factors. |
|---|
| Additional Comments | The soluble form may be used as a prognostic serum biomarker with promising results in respiratory tract carcinomas.crucial role in carcinogenesis and is an attractive target for anticancer treatment with heparanase inhibitors and anti-CD138 antibodies for immunotherapy. |
|---|
| Bibliography | 1.Sun J, Jin Q, Zhang C, Fang X, Gu C, Lei C, Wang J, Chen H. Polymorphisms in the bovine ghrelin precursor (GHRL) and Syndecan-1 (SDC1) genes that are associated with growth traits in cattle. Mol Biol Rep. 2011 Jun;38(5):3153-60. doi: 10.1007/s11033-010-9986-4. Epub 2010 Feb 7. PMID: 20140707. 2.Palaiologou M, Delladetsima I, Tiniakos D. CD138 (syndecan-1) expression in health and disease. Histol Histopathol. 2014 Feb;29(2):177-89. doi: 10.14670/HH-29.177. Epub 2013 Oct 23. PMID: 24150912. 3.Zhang, Y., McKown, R. L., Raab, R. W., Rapraeger, A. C., & Laurie, G. W. (2011). Focus on molecules: syndecan-1. Experimental eye research, 93(4), 329–330. https://doi.org/10.1016/j.exer.2010.06.008 |
|---|
