Search by BoMiProt ID - Bomi9647


Primary Information

BoMiProt ID Bomi9647
Protein Name Synaptotagmin-1/Synaptotagmin I/p65
Organism Bos taurus
Uniprot IDP48018
Milk FractionExosomes
Ref Sequence ID NP_776617.1
Aminoacid Length 422
Molecular Weight 47623
FASTA Sequence Download
Gene Name SYT1
Gene ID 281511
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells occipital lobe 
Protein Function Synaptotagmin-1 (Syt1), a Ca2+ sensor, mediates ultrafast exocytosis in neurons and neuroendocrine cells.
Biochemical Properties C2 domains of Syt1 have membrane-binding affinity and suggested Syt1 as the Ca2+ sensor.Acidic aspartate residues in two Ca2+-binding C2 domains (C2A and C2B), coordinate three and two Ca2+ ions, respectively. In addition to these Ca2+-binding loops, the C2B domain contains a polybasic region (KKKK, 324–327) that is close to Ca2+-binding loops and is enriched with lysine residues that interact with anionic phospholipids or the SNARE complex.
PTMs N-Linked Glycosylation at Asn, Lipoylation, Palmitoylation, Phosphorylation at Ser/Thr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P48018|SYT1_BOVIN Synaptotagmin-1 OS=Bos taurus OX=9913 GN=SYT1 PE=1 SV=1 MVSESHHEALAAPPVTTVATVLPHN*25ATEPASPGEGKEDAFSKLKEKFMNELHKIPLPPWA LIAIAIVAVLLVLTCCFCICKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALK DDDAETGLT*129DGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDP YVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVY*230DFDRFSKHDI IGEFKVPMNTVDFGHVTEEWRDLQS*265AEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNL KKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNES*343FS*345FEVPFEQIQKVQVVV TVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAV KK
Predicted Disorder Regions 10-36, 84-140, 321-329
DisProt Annotation
TM Helix Prediction 1TMH; (58-80)
Additional Comments  Syt-1 is involved in the development of neuropathic pain and that EA attenuates neuropathic pain, probably through suppressing Syt-1 protein expression in the spinal cord.
Bibliography 1.Park Y, Ryu JK. Models of synaptotagmin-1 to trigger Ca2+ -dependent vesicle fusion. FEBS Lett. 2018 Nov;592(21):3480-3492. doi: 10.1002/1873-3468.13193. Epub 2018 Jul 30. PMID: 30004579. 2.Perin MS, Fried VA, Mignery GA, Jahn R and Sudhof TC (1990) Phospholipid binding by a synaptic vesicle protein homologous to the regulatory region of protein kinase C. Nature 345, 260– 263. 3.Fernandez I, Arac D, Ubach J, Gerber SH, Shin O, Gao Y, Anderson RG, Sudhof TC and Rizo J (2001) Three-dimensional structure of the synaptotagmin 1 C2B-domain: synaptotagmin 1 as a phospholipid binding machine. Neuron 32, 1057– 1069. 4.Sutton RB, Davletov BA, Berghuis AM, Sudhof TC and Sprang SR (1995) Structure of the first C2 domain of synaptotagmin I: a novel Ca2 + /phospholipid-binding fold. Cell 80, 929– 938. 5.Ubach J, Zhang X, Shao X, Sudhof TC and Rizo J (1998) Ca2 + binding to synaptotagmin: how many Ca2 + ions bind to the tip of a C2-domain? EMBO J 17, 3921– 3930. 6.Arac D, Chen X, Khant HA, Ubach J, Ludtke SJ, Kikkawa M, Johnson AE, Chiu W, Sudhof TC and Rizo J (2006) Close membrane-membrane proximity induced by Ca(2 + )-dependent multivalent binding of synaptotagmin-1 to phospholipids. Nat Struct Mol Biol 13, 209– 217.