Primary Information |
|---|
| BoMiProt ID | Bomi9533 |
|---|
| Protein Name | Stomatin-like protein 2, mitochondrial/SLP-2 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q32LL2 |
|---|
| Milk Fraction | Whey,Casein |
|---|
| Ref Sequence ID | NP_001033157.1 |
|---|
| Aminoacid Length | 356 |
|---|
| Molecular Weight | 38733 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | STOML2 |
|---|
| Gene ID | 510324 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | an inner mitochondrial membrane protein,a regulator of mitochondrial biogenesis and ATP production.STOML2 activated MEK/ERK signaling and suppressed mitochondrial apoptosis pathway in HeLa cervical cancer cells, through altering the ability of mitochondria to buffer Ca2+ and shape cytosolic Ca2+ signaling. |
|---|
| Significance in milk | phosphorylation on Ser and Tyr.Acetylation on Lys |
|---|
| PTMs | Acetylation, Lipidation, Phosphorylation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q32LL2|STML2_BOVIN Stomatin-like protein 2, mitochondrial OS=Bos taurus OX=9913 GN=STOML2 PE=2 SV=1
MLARAARGTGALLLKGS*17VQASARAPRRASSGLPRNTVVLFVPQQEAWVVERMGRFHRILE
PGLNILIPVLDRIRYVQSLKEIVINVPEQSAVTLDNVTLQIDGVLYLRIMDPYKASYGVE
DPEY*124AVTQLAQTTMRSELGKLSLDKVFRERESLNASIVDAINQAADCWGIRCLRYEIKDI
HVPPRVKESMKMQVEAERRKRATVLESEGTRESAINVAEGKKQAQILASEAEKAEQINQA
AGEASAVLAKAKAKAEAIRILAAALTQHNGDAAASLTVAEQYVSAFSKLAKDSNTILLPS
NPGDVTSMVAQAMGVYGALTKAPIPEAQDS*330VSSRSSRDVRSTDASLDEELDRVKLS |
|---|
| Predicted Disorder Regions | 1-10, 18-29, 318-356 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Bibliography | 1.Ma, W., Chen, Y., Xiong, W. et al. STOML2 interacts with PHB through activating MAPK signaling pathway to promote colorectal Cancer proliferation. J Exp Clin Cancer Res 40, 359 (2021). https://doi.org/10.1186/s13046-021-02116-0. 2.Zhang H, Wu G, Feng J, Lu X, Liu P. Expression of STOML2 promotes proliferation and glycolysis of multiple myeloma cells via upregulating PAI-1. J Orthop Surg Res. 2021 Nov 13;16(1):667. doi: 10.1186/s13018-021-02819-2. PMID: 34774067; PMCID: PMC8590323. |
|---|
