Primary Information |
|---|
| BoMiProt ID | Bomi9464 |
|---|
| Protein Name | Spliceosome-associated protein CWC15 homolog |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q2KJD3 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001039864.1 |
|---|
| Aminoacid Length | 231 |
|---|
| Molecular Weight | 26869 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | CWC15 |
|---|
| Gene ID | 535258 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | associates with CDC5L and maintain to maintain Prp19 spliceosomal complex.to maintain the integrity of the complex and to support efficient splicing. |
|---|
| Biochemical Properties | crooslinks are formed between K28 at the N-terminus of CDC5L and K92 of CWC15 . |
|---|
| PTMs | Acetylation on Lys and Thr, Phosphorylation on Ser and Thr |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q2KJD3|CWC15_BOVIN Spliceosome-associated protein CWC15 homolog OS=Bos taurus OX=9913 GN=CWC15 PE=2 SV=1
MTTAARPTFEPARGGRGKGEGDLSQLSKQYSSRDLPSHTKIKYRQTT*47QDAPEEVRNRDFR
RELEERERAAAREKNRDRPTREHTTSSSVSKKPRLDQIPAANLDADDPLT*110DEEDEDEDFE
EES*123DDDDTAALLAELEKIKKERAEEQARKEQEQKAEEERIRMENILSGNPLLNLTGPSQP
QANFKVKRRWDDDVVFKNCAKGVDDQKKDKRFVNDTLRSEFHKKFMEKYIK |
|---|
| Predicted Disorder Regions | 1-192, 198-209, 216-231 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | no TM helices |
|---|
| Bibliography | van Maldegem F, Maslen S, Johnson CM, Chandra A, Ganesh K, Skehel M, Rada C. CTNNBL1 facilitates the association of CWC15 with CDC5L and is required to maintain the abundance of the Prp19 spliceosomal complex. Nucleic Acids Res. 2015 Aug 18;43(14):7058-69. doi: 10.1093/nar/gkv643. Epub 2015 Jun 29. PMID: 26130721; PMCID: PMC4538830. |
|---|
