Primary Information |
|---|
| BoMiProt ID | Bomi9228 |
|---|
| Protein Name | Small acidic protein |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q3MHL8 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001030551.1 |
|---|
| Aminoacid Length | 181 |
|---|
| Molecular Weight | 20108 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | SMAP |
|---|
| Gene ID | 616182 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | Arf‐specific GTPase activating proteins,bind to Clathrin heavy chains and involved in the trafficking of clathrin‐coated vesicles |
|---|
| Biochemical Properties | LLGLD (aa 192–196) of SMAP1 and LLGLD (aa 187–191) and DLL (aa 212–214) of SMAP2 are thought to be responsible for the interaction with clathrin.Carboxy terminal region contains a unique abundance of Gln, Gly, Met, and Pro residues. |
|---|
| PTMs | Phosphorylation on Ser and Thr,Ubl conjugation,Acetylation on Lys. |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q3MHL8|SMAP_BOVIN Small acidic protein OS=Bos taurus OX=9913 GN=SMAP PE=2 SV=1
MSAARESHPHGVKRS*15AS*17PDDDLGSSNWEAADLGNEERKQKFLRLMGAGKKEHTGRLVIGD
HKS*63TSHFRTGEEDKKINEELESQYQQS*87MDSKLSGRYRRHCGLGFSEVDDHDGEGDVAGDD
DDDDS*125PDPESPDDSESDSESEKEES*145TEELQAAEHPDEVEDSKNKKDAKSNYKMMFVKSSG
S |
|---|
| Predicted Disorder Regions | 1-181 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Bibliography | Tanabe K, Kon S, Ichijo N, Funaki T, Natsume W, Watanabe T, Satake M. A SMAP gene family encoding ARF GTPase-activating proteins and its implication in membrane trafficking. Methods Enzymol. 2008;438:155-70. doi: 10.1016/S0076-6879(07)38011-7. PMID: 18413247. |
|---|
