Primary Information |
|---|
| BoMiProt ID | Bomi9190 |
|---|
| Protein Name | Sin3 histone deacetylase corepressor complex component SDS3/Suppressor of defective silencing 3 protein homolog |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | A6H6W9 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001092361.1 |
|---|
| Aminoacid Length | 328 |
|---|
| Molecular Weight | 38133 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | SUDS3/SDS3 |
|---|
| Gene ID | 506646 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | functions to tether sequence-specific transcriptional repressors to histone deacetylase activity.appears to interact with the human Swi/Snf chromatin-remodeling complex,suggesting that the mSin3A complex may acquire chromatin-remodeling capacity via an indirect mechanism. |
|---|
| Biochemical Properties | C-terminal region of mSin3 that is required for HDAC1 interaction known as histone deacetylase interaction domain (HID). |
|---|
| PTMs | Acetylation, Isopeptide bond formation, Phosphorylation, Ubl conjugation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|A6H6W9|SDS3_BOVIN Sin3 histone deacetylase corepressor complex component SDS3 OS=Bos taurus OX=9913 GN=SUDS3 PE=2 SV=1
MSAAALLAPAPAPAGAPPAPEYYPEEDEELES*32AEDDERSCRGRES*45DEDT*49EDAS*53ETDLAKH
DEEDFVEMKEQMYQDKLASLKRQLQQLQEGTLQEYQKRMKKLDQQYKERIRNAELFLQLE
TEQVERNYIKEKKAAVKEFEDKKVELKENLIAELEEKKKMIENEKLTMELTGDSMEVKPI
MTRKLRRRPNDPVPIPDKRRKPAPAQLNYLLTDEQIMEDLRTLNKLKS*228PKRPAS*334PSS*337PEH
LPTT*344PAESPAQRFEARIEDGKLYYDKRWYHKSQAIYLESKDNQKLSCVISSVGANEIWVR
KTSDSTKMRIYLGQLQRGLFVIRRRSAA
|
|---|
| Predicted Disorder Regions | 1-105, 137-141, 169-211, 218-261 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | 'Lys-63'-polyubiquitinated SUDS3 positively regulates histone deacetylation. |
|---|
| Bibliography | Fleischer TC, Yun UJ, Ayer DE. Identification and characterization of three new components of the mSin3A corepressor complex. Mol Cell Biol. 2003 May;23(10):3456-67. doi: 10.1128/MCB.23.10.3456-3467.2003. PMID: 12724404; PMCID: PMC164750. |
|---|
