Primary Information |
---|
BoMiProt ID | Bomi9003 |
---|
Protein Name | Selenoprotein P |
---|
Organism | Bos taurus |
---|
Uniprot ID | P49907 |
---|
Milk Fraction | Casein,MFGM |
---|
Ref Sequence ID | NP_776884.2 |
---|
Aminoacid Length | 402 |
---|
Molecular Weight | 45488 |
---|
FASTA Sequence |
Download |
---|
Gene Name | SELENOP |
---|
Gene ID | 282066 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Presence in other biological fluids/tissue/cells | found in plasma |
---|
Protein Function | play an important role in developing and/or modulating the morphology of neurons and/or glial cells. |
---|
Biochemical Properties | Selenoprotein P (SeP) is an extracellular, monomeric glycoprotein containing up to 10 selenocysteine residues in the polypeptide chain |
---|
Significance in milk | Major selenium transporter protein in milk principally produced in liver and lung.High intake of Se might be related to high levels of plasma selenoprotein P, yet low GPx activity, observed in Type 2 diabetes. |
---|
PTMs | Phosphorylation,Glycosylation |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|P49907|SEPP1_BOVIN Selenoprotein P OS=Bos taurus OX=9913 GN=SELENOP PE=2 SV=2
MWRGLGLALALCLLLTGGTESQGQSSYCKQPPPWSIKDQDPMLNSYGSVTVVALLQASUY
LCILQASRLEDLRVKLEKEGYSN*83ISYVVVNHQGISSRLKYVHLKNKVSEHIPVYQQEENQ
PDVWTLLNGNKDDFLIYDRCGRLVYHLGLPYSFLTFTYVEDSIKTVYCEDKCGN*174CSLKAL
EDEDVCKNVFLATKEKTAEASQRHHHPHPHSHPHPHPHPHPHPHPHPHHGHQLHENAHLS
ESPKPDTPDTPENPPPSGLHHHHHRHKGPQRQGHSDNCDTPVGS*284ESLQPSLPQKKLURKR
CINQLLUQFPKDSESALSSCCCHCRHLVFEKTGSAITUQCTEKLPSLCSUQGLLAEENVI
ESUQURLPPAAUQAAGQQLNPTEASTKUSUKNKAKMUKUPSN
|
---|
Predicted Disorder Regions | (196-291), (366-402) |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Significance of PTMs | |
---|
Additional Comments | Some diseases may be associated with high levels of Se markers (e.g., GPx and selenoprotein P). Findings indicate that high Se exposure may be associated with Type 2 diabetes. |
---|
Bibliography | 1.Claudia Cobo-Angel, Jeffrey Wichtel, Alejandro Ceballos-Márquez, Selenium in milk and human health, Animal Frontiers, Volume 4, Issue 2, April 2014, Pages 38–43, https://doi.org/10.2527/af.2012-0013 2.Saijoh K, Saito N, Lee MJ, Fujii M, Kobayashi T, Sumino K. Molecular cloning of cDNA encoding a bovine selenoprotein P-like protein containing 12 selenocysteines and a (His-Pro) rich domain insertion, and its regional expression. Brain Res Mol Brain Res. 1995 Jun;30(2):301-11. doi: 10.1016/0169-328x(94)00007-2. PMID: 7637580. |