Primary Information |
|---|
| BoMiProt ID | Bomi8997 |
|---|
| Protein Name | Secretory carrier-associated membrane protein 4 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q58DF6 |
|---|
| Milk Fraction | Exosomes |
|---|
| Ref Sequence ID | NP_001019737.1 |
|---|
| Aminoacid Length | 230 |
|---|
| Molecular Weight | 25595 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | SCAMP4 |
|---|
| Gene ID | 538819 |
|---|
| Protein Existence Status | Reviewed |
|---|
Secondary Information |
|---|
| Presence in other biological fluids/tissue/cells | pons |
|---|
| Protein Function | SCAMP4 belongs to the Secretory carrier membrane proteins (SCAMPs) family which were initially found in components of regulated secretory carriers in secretory and endocytic.SCAMP4 is a novel cells surface
protein to promote the secretion of SASP factor and enhance the SASP phenotype by accumulating on the surface of senescent cells. |
|---|
| PTMs | Phosphorylation at Thr |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q58DF6|SCAM4_BOVIN Secretory carrier-associated membrane protein 4 OS=Bos taurus OX=9913 GN=SCAMP4 PE=2 SV=1
MSGKENNFPPLPKFIPLKPCFYQNFSDEIPIEHQVLVKRIYRLWLFYCATLGVNLVACLA
WWIAGGSGANFGLALLWLLLFSPCGYVCWFRPAYKAFRSDSSFNFMAFFFIFGAQFILTI
IQAVGFSGWGACGWLAAIGFFQTSVGAAVVMLLPAIMFSMSAAMMAVMIMKVHSIYRGTG
GSFQKAQTEWSTGT*194WRNPPSREAQFNNFSGNSLPEYPTVPSYPASGGQWP
|
|---|
| Predicted Disorder Regions | 1-7, 185-230 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | 1TMH; (43-65),(69-91),(104-126),(145-167) |
|---|
| Bibliography | 1.Ge X, Wang Z, Jiang R, Ren S, Wang W, Wu B, Zhang Y, Liu Q. SCAMP4 is a novel prognostic marker and correlated with the tumor progression and immune infiltration in glioma. Int J Biochem Cell Biol. 2021 Oct;139:106054. doi: 10.1016/j.biocel.2021.106054. Epub 2021 Aug 12. PMID: 34390854. |
|---|
