Primary Information |
---|
BoMiProt ID | Bomi8994 |
---|
Protein Name | Secretogranin-1/Chromogranin-B/Secretogranin I |
---|
Organism | Bos taurus |
---|
Uniprot ID | P23389 |
---|
Milk Fraction | Whey |
---|
Ref Sequence ID | NP_851349.1 |
---|
Aminoacid Length | 646 |
---|
Molecular Weight | 73340 |
---|
FASTA Sequence |
Download |
---|
Gene Name | CHGB |
---|
Gene ID | 281071 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | CgB is necessary for efficient trafficking of secretory proteins into the budding granule, which impacts the availability of insulin-containing secretory granules for exocytic release. |
---|
Biochemical Properties | CgB, also known as secretogranin I, belongs to the same granin family as CgA. CgB is a secretory protein consisting of 657 amino acids, localized in the healthy pancreas and within secretory granules of neuroendocrine cells, and it regulates hormone production via intracellular processing |
---|
PTMs | Disulfide bond formation,O-Linked Glycosylation at Thr, Phosphorylation at Ser-168,351,354,584,593 and 598,Sulfation at Tyr |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|P23389|SCG1_BOVIN Secretogranin-1 OS=Bos taurus OX=9913 GN=CHGB PE=1 SV=2
MQPAALLGLLGATVVAAVSSMPVDIRNHNEEVVTHCIIEVLSNALLKSSAPPITPECRQV
LKKNGKELKNEEKS*74ENENT*79RFEVRLLRDPADT*92S*93EAPGLS*99S*100REDS*104GEGDAQVPT*113VADTESG
GHS*123RERAGEPPGSQVAKEAKTRYSKS*146EGQNREEEMVKYQKRERGEVGS*168EERLSEGPGKAQ
TAFLNQRNQT*190PAKKEELVSRYDTQS*205ARGLEKSHSRERSSQESGEETKSQENWPQELQRHP
EGQEAPGESEEDASPEVDKRHSRPRHHHGRSRPDRS*276S*277QEGNPPLEEESHVGTGNS*295DEEKA
RHPAHFRALEEGAEYGEEVRRHSAAQAPGDLQGARFGGRGRGEHQALRRPS*351EES*354LEQENK
RHGLSPDLNMAQGY*374S*375EES*378EEERGPAPGPSYRARGGEAAAYSTLGQTDEKRFLGETHHRVQ
ESQRDKARRRLPGELRNYLDYGEEKGEEAARGKWQPQGDPRDADENREEARLRGKQYAPH
HITEKRLGELLNPFYDPSQWKS*502S*503RFERKDPMDDS*514FLEGEEENGLTLNEKNFFPEYNYDWW
EKKPFEEDVNWGYEKRNPVPKLDLKRQYDRVAELDQLLHYRKKS*584AEFPDFYDS*593EEQMS*598PQ
HTAENEEEKAGQGVLTEEEEKELENLAAMDLELQKIAEKFSGTRRG
|
---|
Predicted Disorder Regions | 13-21, 42-476, 592-646 |
---|
DisProt Annotation | |
---|
TM Helix Prediction | no TM helices |
---|
Significance of PTMs | All PTM leads to a complex structure of this protein making it a marker of the neuroendocrine system. |
---|
Additional Comments | Loss of CgB impairs glucose-stimulated insulin secretion, impedes proinsulin processing to yield increased proinsulin content, and alters the density of insulin-containing granules. |
---|
Bibliography | 1.Bearrows SC, Bauchle CJ, Becker M, Haldeman JM, Swaminathan S, Stephens SB. Chromogranin B regulates early-stage insulin granule trafficking from the Golgi in pancreatic islet β-cells. J Cell Sci. 2019 Jul 1;132(13):jcs231373. doi: 10.1242/jcs.231373. PMID: 31182646; PMCID: PMC6633396. 2.Miki M, Ito T, Hijioka M, Lee L, Yasunaga K, Ueda K, Fujiyama T, Tachibana Y, Kawabe K, Jensen RT, Ogawa Y. Utility of chromogranin B compared with chromogranin A as a biomarker in Japanese patients with pancreatic neuroendocrine tumors. Jpn J Clin Oncol. 2017 Jun 1;47(6):520-528. doi: 10.1093/jjco/hyx032. PMID: 28334992; PMCID: PMC6283109. 3.Gasnier C, Lugardon K, Ruh O, Strub JM, Aunis D, Metz-Boutigue MH. Characterization and location of post-translational modifications on chromogranin B from bovine adrenal medullary chromaffin granules. Proteomics. 2004 Jun;4(6):1789-801. doi: 10.1002/pmic.200300693. PMID: 15174145. |