Primary Information |
|---|
| BoMiProt ID | Bomi8930 |
|---|
| Protein Name | RuvB-like 2 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q2TBU9 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001033615.1 |
|---|
| Aminoacid Length | 463 |
|---|
| Molecular Weight | 51170 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | RUVBL2 |
|---|
| Gene ID | 511048 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | highly conserved ATPases that belong to the AAA+ (ATPases Associated with various cellular Activities) superfamily and are involved in various complexes and cellular processes, several of which are closely linked to oncogenesis.DNA damage signaling and repair, chromatin remodeling, telomerase activity, and in modulating the transcriptional activities of proto-oncogenes such as c-Myc and β-catenin. transcriptional repressor of ARF |
|---|
| Biochemical Properties | Forms homohexameric rings .Can form a dodecamer with RUVBL1. has a unique Domain II (DII) that protrudes from the core of the protein and it is organized in an external region containing an Oligonucleotide/oligosaccharide-Binding (OB)-fold domain and an internal region made of a helical bundle and a ß-stalk.N-terminal segment of RUVBL2 acts as a gatekeeper to control nucleotide binding. |
|---|
| PTMs | Acetylation, Isopeptide bond, Phosphorylation, Ubl conjugation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q2TBU9|RUVB2_BOVIN RuvB-like 2 OS=Bos taurus OX=9913 GN=RUVBL2 PE=2 SV=3
MATVTATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVL
EMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALT
QAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIE
SLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVH
TVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDE
VHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTS
PYSEKDKKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTE
VQVDDIKRVYSLFLDES*437RSTQYMKEYQDAFLFNELKGETMDTS
|
|---|
| Predicted Disorder Regions | NA |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | no TM helices |
|---|
| Bibliography | Dauden MI, López-Perrote A, Llorca O. RUVBL1-RUVBL2 AAA-ATPase: a versatile scaffold for multiple complexes and functions. Curr Opin Struct Biol. 2021 Apr;67:78-85. doi: 10.1016/j.sbi.2020.08.010. Epub 2020 Oct 28. PMID: 33129013. |
|---|
