Primary Information |
|---|
| BoMiProt ID | Bomi8860 |
|---|
| Protein Name | RNA demethylase ALKBH5/Alkylated DNA repair protein alkB homolog 5/Alpha-ketoglutarate-dependent dioxygenase alkB homolog 5 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | E1BH29 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001192446.1 |
|---|
| Aminoacid Length | 394 |
|---|
| Molecular Weight | 44097 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | ALKBH5 |
|---|
| Gene ID | 533303 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | Dioxygenase,demethylates RNA by oxidative demethylation.specifically demethylates N6-methyladenosine (m6A) RNA. |
|---|
| Biochemical Properties | Requires molecular oxygen, alpha-ketoglutarate and iron.Binds 1 Fe2+ per subunit. |
|---|
| PTMs | Acetylation, Isopeptide bond formation, phosphorylation, Ubl conjugation,Sumoylation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|E1BH29|ALKB5_BOVIN RNA demethylase ALKBH5 OS=Bos taurus OX=9913 GN=ALKBH5 PE=3 SV=1
MAAASGYTDLREKLKSMTSRDNYKAGSREAAAAAAAAVAAAAAAAAAAEPYAAPGVKRKY
PEDS*64DPERS*69DFEEQQLQKEEEARKVKSGIRQMRLFSQDECAKIEARIDEVVSRAEKGLYN
EHTVDRAPLRNKYFFGEGYTYGAQLQKRGPGQERLYPPGDVDEIPEWVHQLVIQKLVEHR
VIPEGFVNSAVINDYQPGGCIVSHVDPIHIFERPIVSVSFFSDSALCFGCKFQFKPIRVS
EPVLSLPVRRGSVTVLSGYAADEITHCIRPQDIKERRAVIILRKTRLDAPRLETKSLSSS
VLPPSYASDRLSGNNRDPALKPKRSHRKADPDAAHRPRILEMDKEENRRSVLLPAHRRAG
RFSSENYRRKS*371YEPGEDCSEAAGS*384PARKVKMRRH
|
|---|
| Predicted Disorder Regions | 1-11, 20-25, 49-81, 147-160, 292-343, 343-345, 358-394 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | phosphorylation at serine residues S87 and S325 by ERK/JNK.ALKBH5 phosphorylation facilitates ALKBH5 SUMOylation by promoting the interaction between ALKBH5 and SUMO E2 UBC9. ALKBH5 is modified by SUMO-1 mainly at lysine residues K86 and K321, which is mediated by the SUMO E3 ligase PIAS4. |
|---|
| Bibliography | Li N, Kang Y, Wang L, Huff S, Tang R, Hui H, Agrawal K, Gonzalez GM, Wang Y, Patel SP, Rana TM. ALKBH5 regulates anti-PD-1 therapy response by modulating lactate and suppressive immune cell accumulation in tumor microenvironment. Proc Natl Acad Sci U S A. 2020 Aug 18;117(33):20159-20170. doi: 10.1073/pnas.1918986117. Epub 2020 Aug 3. PMID: 32747553; PMCID: PMC7443867. |
|---|
