Primary Information |
|---|
| BoMiProt ID | Bomi8815 |
|---|
| Protein Name | RING finger protein 11 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q08DI6 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001071421.1 |
|---|
| Aminoacid Length | 154 |
|---|
| Molecular Weight | 17444 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | RNF11 |
|---|
| Gene ID | 522791 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | role in in growth factor signalling, ubiquitination and transcriptional regulation.RNF11 is capable of enhancing TGFβ signalling directly and by inhibition of Smurf2-mediated downregulation of the TGFβ signal.Has a pro-apoptotic effect on cells that remain sensitive to DNA damage-induced apoptosis or TGFβ-induced apoptosis . |
|---|
| Biochemical Properties | has modular domains and motifs including a RING-H2 finger domain, a PY motif, an ubiquitin interacting motif (UIM), a 14-3-3 binding sequence and an AKT phosphorylation site. |
|---|
| PTMs | Lipidation, Myristoylation, Palmitoylation, Phosphorylation, Ubl conjugation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q08DI6|RNF11_BOVIN RING finger protein 11 OS=Bos taurus OX=9913 GN=RNF11 PE=2 SV=1
MGNCLKSPTSDDIS*14LLHESQSDRAS*25FGEGTEPDQEPPPPYQEQVPVPVYHPTPSQTRLAT
QLTEEEQIRIAQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHI
YHLDCIDDWLMRSFT*135CPSCMEPVDAALLSSYETN
|
|---|
| Predicted Disorder Regions | 1-66, 151-154 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | phosphorylation may modulate its activity.when it is bound by ubiquitin 14-3-3 related to its normal function and intracellular localisation of the RNF11 protein. In order to confer 14-3-3 binding to RNF11, the threonine within this site is phosphorylated by AKT.RNF11 function is negatively regulated by AKT phosphorylation and 14-3-3 binding. |
|---|
| Bibliography | Azmi P, Seth A. RNF11 is a multifunctional modulator of growth factor receptor signalling and transcriptional regulation. Eur J Cancer. 2005 Nov;41(16):2549-60. doi: 10.1016/j.ejca.2005.08.020. Epub 2005 Oct 13. PMID: 16226459. |
|---|
