Primary Information |
---|
BoMiProt ID | Bomi8801 |
---|
Protein Name | Ribosomal protein S6 kinase beta-1/S6K-beta-1/S6K1/70 kDa ribosomal protein S6 kinase 1/P70S6K1/p70-S6K 1 |
---|
Organism | Bos taurus |
---|
Uniprot ID | Q6TJY3 |
---|
Milk Fraction | Whey |
---|
Ref Sequence ID | NP_991385.1 |
---|
Aminoacid Length | 527 |
---|
Molecular Weight | 59352 |
---|
FASTA Sequence |
Download |
---|
Gene Name | RPS6KB1 |
---|
Gene ID | 404181 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | Serine/threonine-protein kinase that acts downstream of mTOR signaling.Regulates protein synthesis through phosphorylation of EIF4B, RPS6 and EEF2K, and contributes to cell survival by repressing the pro-apoptotic function of BAD. |
---|
Significance in milk | role in milk protein synthesis |
---|
PTMs | phosphorylation |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q6TJY3|KS6B1_BOVIN Ribosomal protein S6 kinase beta-1 OS=Bos taurus OX=9913 GN=RPS6KB1 PE=2 SV=1
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG
PYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF
AMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGEL
FMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLC
KESIHDGTVTHT*252FCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK
TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEEL
LARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDS*394PDDSALSESANQVFLGFT*412YVAPSVLE
SVKEKFSFEPKIRS*434PRRFIGS*441PRT*444PVS*447PVKFS*452PGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNLEL
|
---|
Predicted Disorder Regions | 1-75, 388-400, 430-498, 503-526 |
---|
DisProt Annotation | |
---|
TM Helix Prediction | no TM helices |
---|
Significance of PTMs | phosphorylation-p70S6K1 protects myocardial cells from ischemic injury.Decreased p70S6K1 phosphorylation induces cell cycle arrest and apoptosis. mTOR phosplorylated at Ser2448; S6K1, p70 ribosomal protein S6 kinase-1; S6K1 (Thr389). The phosphorylation of S6K1 leads to the activation of several components of the protein translation apparatus in cells. |
---|
Bibliography | 1.Li, H., Liu, X., Wang, Z., Lin, X., Yan, Z., Cao, Q., Zhao, M., & Shi, K. (2017). MEN1/Menin regulates milk protein synthesis through mTOR signaling in mammary epithelial cells. Scientific reports, 7(1), 5479. https://doi.org/10.1038/s41598-017-06054-w 2.Xie Q, Liu M, Yan YF, Shen X, Wang ES. Exogenous Tetranectin Protects Against 1-Methyl-4-Phenylpyridine-Induced Neurotoxicity by Inhibiting Apoptosis and Autophagy Through Ribosomal Protein S6 Kinase Beta-1. World Neurosurg. 2019 Feb;122:e375-e382. doi: 10.1016/j.wneu.2018.10.058. Epub 2018 Oct 18. PMID: 30342268. |