Primary Information |
---|
BoMiProt ID | Bomi8784 |
---|
Protein Name | Ribonuclease P protein subunit p30/RNaseP protein p30/RNase P subunit 2 |
---|
Organism | Bos taurus |
---|
Uniprot ID | Q3SZ21 |
---|
Milk Fraction | Whey |
---|
Ref Sequence ID | NP_001030538.1 |
---|
Aminoacid Length | 268 |
---|
Molecular Weight | 29395 |
---|
FASTA Sequence |
Download |
---|
Gene Name | RPP30/RNASEP2 |
---|
Gene ID | 615098 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | Component of ribonuclease P, a ribonucleoprotein complex that generates mature tRNA molecules by cleaving their 5'-ends. |
---|
Biochemical Properties | Ribonuclease P protein subunit p30 (RPP30), a component of ribonuclease P (RNase P), generates mature tRNA molecules by cleaving the 5'-end. |
---|
PTMs | Acetylation, Phosphorylation |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q3SZ21|RPP30_BOVIN Ribonuclease P protein subunit p30 OS=Bos taurus OX=9913 GN=RPP30 PE=2 SV=1
MAVFADLDLRAGSDLKALRGLVENAAHLGYSVVAINHVVEFKEKKQEIEKPVAVSELFTT
LPIVQGKSKPIKILTRLTIIVSDPSHCNVLRATSSRVRLYDIVAVFPKTEKLFHVACTHL
DVDLVCITVTEKLPFYFKRPPINVAIDRGVGFELLYSPAIKDSTMRRYTISNALNLMQVC
KGKNVIISSAAERPLEIRGPYDVANLGLLFGLSESDAKAAVSTNCRAVLLHGETRKTAFG
IISTVKKPRTS*251EADDDSLPACKKAKCES
|
---|
Predicted Disorder Regions | 248-268 |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Bibliography | Li G, Zhai Y, Liu H, Wang Z, Huang R, Jiang H, Feng Y, Chang Y, Wu F, Zeng F, Jiang T, Zhang W. RPP30, a transcriptional regulator, is a potential pathogenic factor in glioblastoma. Aging (Albany NY). 2020 Jul 23;12(16):16155-16171. doi: 10.18632/aging.103596. Epub 2020 Jul 23. PMID: 32702667; PMCID: PMC7485703. |