Primary Information |
|---|
| BoMiProt ID | Bomi8779 |
|---|
| Protein Name | Ribonuclease H2 subunit B/Ribonuclease HI subunit B/RNase H2 subunit B |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q3ZBI3 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001160038.1 |
|---|
| Aminoacid Length | 309 |
|---|
| Molecular Weight | 35008 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | RNASEH2B |
|---|
| Gene ID | 509258 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | plays an essential role for genome stability as it removes ribonucleotides misincorporated into genomic DNA by replicative polymerases and resolves RNA/DNA hybrids. |
|---|
| Biochemical Properties | cleave the RNA moiety in RNA/DNA hybrids.RNase H2 can also hydrolyze the 5′-phosphodiester bond of a single ribonucleotide embedded in a DNA duplex.The human RNase H2 forms a heterotrimeric complex consisting of the catalytic RNase H2A subunit, which is characterized by a metal binding DEDD motif (D24, E35, D141, D169), and two auxiliary subunits RNase H2B and RNase H2C.The auxiliary B and C subunits adopt an interwoven triple β-barrel folded together with the C-terminal extension of the A subunit located on the C-terminal half of RNase H2C . |
|---|
| PTMs | Acetylation and phosphorylation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q3ZBI3|RNH2B_BOVIN Ribonuclease H2 subunit B OS=Bos taurus OX=9913 GN=RNASEH2B PE=2 SV=2
MARGADGGDGASVWQHVFLLPEYLKDDSKKMKSGLVFVKLANPCSGEGTIYLFNMCLPQL
FEIKVFKEKNHSWFINESVQSGGLLHFATPVDPLFLLLHYLIKADKESFQGKFQPLDQVV
MDDMFPDCILLLKLPELEKLLQHVTEEKEVDKKKYYKYSKEKTLKWLGKKVNQTMAALKT
NKVNVSARVQSTAFFSGGQVSSDKDEDYVRYAHGLISDYIPKQLSDDLSKYLKLPEPPAS
VRNPPSKKAKLSDEPVMAKEDYTKFNSKDFKTVKKNSKMTAAQKALAKVDKSGMKS*296IDSF
FGTKHVKKK
|
|---|
| Predicted Disorder Regions | 1-8, 26-36, 233-309 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Additional Comments | Biallelic mutations in the genes encoding the three RNase H2 subunits cause Aicardi-Goutières syndrome (AGS), an early-onset inflammatory encephalopathy |
|---|
| Bibliography | 1.Kind B, Muster B, Staroske W, Herce HD, Sachse R, Rapp A, Schmidt F, Koss S, Cardoso MC, Lee-Kirsch MA. Altered spatio-temporal dynamics of RNase H2 complex assembly at replication and repair sites in Aicardi-Goutières syndrome. Hum Mol Genet. 2014 Nov 15;23(22):5950-60. doi: 10.1093/hmg/ddu319. Epub 2014 Jun 30. PMID: 24986920. 2.Kind B, Muster B, Staroske W, Herce HD, Sachse R, Rapp A, Schmidt F, Koss S, Cardoso MC, Lee-Kirsch MA. Altered spatio-temporal dynamics of RNase H2 complex assembly at replication and repair sites in Aicardi-Goutières syndrome. Hum Mol Genet. 2014 Nov 15;23(22):5950-60. doi: 10.1093/hmg/ddu319. Epub 2014 Jun 30. PMID: 24986920. |
|---|
