Primary Information |
---|
BoMiProt ID | Bomi8698 |
---|
Protein Name | Regulator of microtubule dynamics protein 3/Protein FAM82A2/Protein FAM82C |
---|
Organism | Bos taurus |
---|
Uniprot ID | Q1JQC5 |
---|
Milk Fraction | Whey |
---|
Ref Sequence ID | NP_001069147.1 |
---|
Aminoacid Length | 471 |
---|
Molecular Weight | 51906 |
---|
FASTA Sequence |
Download |
---|
Gene Name | RMDN3/FAM82A2 /FAM82C |
---|
Gene ID | 514748 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | Enables microtubule binding activity. Involved in cellular calcium ion homeostasis. |
---|
Biochemical Properties | PTPIP51 belongs to a protein family that interacts with the microtubule cytoskeleton, also known as microtubule associated proteins, comprising three members specifically called regulator of microtubule dynamics (RMD). |
---|
PTMs | Phosphorylation at Ser |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q1JQC5|RMD3_BOVIN Regulator of microtubule dynamics protein 3 OS=Bos taurus OX=9913 GN=RMDN3 PE=2 SV=1
MSSLGTLGGARAGLGLLLGTAAGLGFLCALYSQRWKRTQRRGQS*44QS*46QSNS*50LDYTQTS*57EPG
RQVRPLRAAPGEAGDAAVLSSLPRGQEVVLDRLEFVLTSLVALRREVEELRSSLQGLAGQ
IVGEVRSHMEENQKVARRRRFPFARERSDSTGSSSVYFTAASGATFTDAESEGGYTTANA
ES*182DYERDSERES*192DGDGEDEVSCETVKMGRKDS*212LDLEVEVALGLEPEAPEAGGS*233PGQEDVMPLLQQADELHQGSEQGKREGFQLLLNNKLVHGSRQDFLWRLARAYSDMCELTEEASEKRS
YALSGKEEAEVALEKGNENAECHQWYAVLCGQLAEHEGIQRRIQSGFSFKEHVDKAIALK
PENPMAHFLLGRWCYQVSHLSWLEKKTATALSESPLGATVQDALSSFLKAEELQPGFSKA
GRIYICKCYKELGKNPEAKEWMKLALELPNVTKEDSAFQKDLEELEVILGE
|
---|
Predicted Disorder Regions | 39-76, 138-255 |
---|
DisProt Annotation | |
---|
TM Helix Prediction | 1TMH; (13-31) |
---|
Significance of PTMs | PTPIP51 has no endogenous enzymatic activity, It is assumed that the cellular functions of PTPIP51 are mediated through the previously described protein-protein-binding motifs and the resulting protein-protein interactions. These motifs and protein-protein interactions are under the influence of distinct tyrosine and serine phosphorylation sites in the PTPIP51 protein sequence. |
---|
Additional Comments | Located in several cellular components, including intercellular bridge; mitochondrial outer membrane; and spindle. |
---|
Bibliography | 1.Yeo HK, Park TH, Kim HY, Jang H, Lee J, Hwang GS, Ryu SE, Park SH, Song HK, Ban HS, Yoon HJ, Lee BI. Phospholipid transfer function of PTPIP51 at mitochondria-associated ER membranes. EMBO Rep. 2021 Jun 4;22(6):e51323. doi: 10.15252/embr.202051323. Epub 2021 May 2. PMID: 33938112; PMCID: PMC8183395. 2.Gomez-Suaga P, Paillusson S, Miller CCJ. ER-mitochondria signaling regulates autophagy. Autophagy. 2017 Jul 3;13(7):1250-1251. doi: 10.1080/15548627.2017.1317913. Epub 2017 May 26. PMID: 28548902; PMCID: PMC5529068. 3. Brobeil, Alexander; Dietel, Eric; Gattenlöhner, Stefan; Wimmer, Monika (2017).Orchestrating cellular signaling pathways—the cellular “conductor” protein tyrosine phosphatase interacting protein 51 (PTPIP51). Cell and Tissue Research, 368(3), 411–423.doi:10.1007/s00441-016-2508-5. |