Primary Information |
|---|
| BoMiProt ID | Bomi8690 |
|---|
| Protein Name | Regulator of G-protein signaling 19 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q08DC7 |
|---|
| Milk Fraction | Exosomes,MFGM |
|---|
| Ref Sequence ID | NP_001070383.1 |
|---|
| Aminoacid Length | 223 |
|---|
| Molecular Weight | 25353 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | RGS19 |
|---|
| Gene ID | 539036 |
|---|
| Protein Existence Status | Reviewed |
|---|
Secondary Information |
|---|
| Presence in other biological fluids/tissue/cells | leukocyte |
|---|
| Protein Function | Regulator of G protein signaling 19 (RGS19) has recently been shown to inhibit Ras activation by upregulating the tumor metastasis suppressor Nm23. |
|---|
| PTMs | Lipoylation, Palmitoylation, Phosphorylation at Ser |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q08DC7|RGS19_BOVIN Regulator of G-protein signaling 19 OS=Bos taurus OX=9913 GN=RGS19 PE=2 SV=1
MPTPPEAEKQQTGPEEADQPPSMS*24SHDAAPPAPPRRNPCCLCWCCCCSCSWNEERRRAWR
ASRESRLQPLPSCEVCATPTPTPTPTPEEVRSWAQSFDKLMHS*103PAGRSVFREFLRTEYSE
ENMLFWLACEELKAEANQHVVDEKARLIYEDYVSILS*157PKEVSLDSRVREGINKKMQEPSA
HTFDDAQLQIYTLMHRDSYPRFLSSPAYRALLLQGASQSSSEA
|
|---|
| Predicted Disorder Regions | 1-32, 69-92 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | Heavily palmitoylated in the cysteine string motif. |
|---|
| Additional Comments | Elevated expression of RGS19 in HEK293 cells has been shown to impair the responsiveness of JNK and p38 mitogen-activated protein kinase (MAPK) as well as their upstream GTPases Rac1 and Cdc42. |
|---|
| Bibliography | 1.Wang Y, Tong Y, Tso PH, Wong YH. Regulator of G protein signaling 19 suppresses Ras-induced neoplastic transformation and tumorigenesis. Cancer Lett. 2013 Oct 1;339(1):33-41. doi:10.1016/j.canlet.2013.07.025. Epub 2013 Jul 30. PMID: 23911936. 2.A.K.C. Ip, P.H. Tso, M.M.K. Lee, Y.H. Wong.Elevated expression of RGS19 impairs the responsiveness of stress-activated protein kinases to serum.Mol. Cell. Biochem., 362 (2012), pp. 159-168. |
|---|
