Primary Information |
|---|
| BoMiProt ID | Bomi8665 |
|---|
| Protein Name | Receptor expression-enhancing protein 4 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q3ZCI8 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001029705.1 |
|---|
| Aminoacid Length | 257 |
|---|
| Molecular Weight | 29597 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | REEP4 |
|---|
| Gene ID | 519613 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | promotes Nuclear pore complex(NPC) assembly and appears to be particularly important for NPC formation during mitosis. ensure proper cell division and nuclear envelope reassembly,they clear ER from metaphase chromosomes in a microtubule-dependent manner.Essential for the normal, high curvature ER morphology during mitosis. |
|---|
| Biochemical Properties | contains RHD domain which is important for the formation of high curvature ER during mitosis through their RHDs. C-terminus is required to promote normal high curvature ER morphology during metaphase |
|---|
| PTMs | phosphorylation on Ser and thr |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q3ZCI8|REEP4_BOVIN Receptor expression-enhancing protein 4 OS=Bos taurus OX=9913 GN=REEP4 PE=2 SV=1
MVSWMICRLVVLVFGMLYPAYASYKAVKTKNIREYVRWMMYWIVFALFMAVETFTDIFIS
WFPFYYEIKMAFVLWLLSPYTRGASMLYRKFVHPSLSRHEKEIDTYIVQAKERSYETVLS
FGKRGLNIAASAAVQAATKSQGALAGKLRSFS*152MQDLRTIPDGPAPTYQDPLYLEDQVPHR
RPPIGYRAGGLRDS*194DT*196DNECWS*202DTEVVPQPPARPREKPLGRSQSLRVIKRKPLAREGTSR
SLKVRTRKKT*250APS*253DMDS
|
|---|
| Predicted Disorder Regions | 153-257 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | 2TMHs; (4-22), (42-64) |
|---|
| Bibliography | Kumar D, Golchoubian B, Belevich I, Jokitalo E, Schlaitz AL. REEP3 and REEP4 determine the tubular morphology of the endoplasmic reticulum during mitosis. Mol Biol Cell. 2019 Jun 1;30(12):1377-1389. doi: 10.1091/mbc.E18-11-0698. Epub 2019 Apr 17. PMID: 30995177; PMCID: PMC6724692. |
|---|
