Primary Information |
---|
BoMiProt ID | Bomi8551 |
---|
Protein Name | Pyridoxal phosphate homeostasis protein/Proline synthase co-transcribed bacterial homolog protein/Pyridoxal phosphate-binding protein |
---|
Organism | Bos taurus |
---|
Uniprot ID | Q3T0G5 |
---|
Milk Fraction | Whey |
---|
Ref Sequence ID | NP_001029529.1 |
---|
Aminoacid Length | 273 |
---|
Molecular Weight | 29943 |
---|
FASTA Sequence |
Download |
---|
Gene Name | PLPBP/PROSC |
---|
Gene ID | 509643 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | This protein family plays a significant role in the homeostasis of vitamin B6 and amino acids. |
---|
Biochemical Properties | The crystal structures of YggS protein family members, E. coli YggS ,Saccharomyces cerevisiae Ybl036c and Synechococcus elongatus PCC 7942 PipY demonstrated that the proteins bind to PLP via Schiff base linkage with a lysine residue and exhibit structural similarity with the N -terminal domain of bacterial alanine racemase (ALR) and eukaryotic ornithine decarboxylase (ODC), both of which are classified as fold-type III PLP enzymes. |
---|
PTMs | Phosphorylation at Ser |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q3T0G5|PLPHP_BOVIN Pyridoxal phosphate homeostasis protein OS=Bos taurus OX=9913 GN=PLPBP PE=2 SV=1
MWKAGS*6MSAELGIGFALRAVNERVQQAVARRPRDLPAIQPRLVAVSKTKPADMVIEAYSH
GQRTFGENY*69VQELLEKASNPQILSSCPEIKWHFIGHLQKQNVNKLMAVPNLSMLETVDSV
KLADKVNSAWQKKGSPERLKVMVQINTSGEASKHGLPPAEMAALVEHINAKCPSLEFVGL
MTIGSFGHDLSQGPNPDFQVLLSLREELCRKLGAPPEQVELSMGMS*226VDFQHAIEVGSTNV
RIGS*244TIFGERDYSKKTDKPAAELQAPEEVAQAH
|
---|
Predicted Disorder Regions | 1-7, 250-273 |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Additional Comments | The deletion or mutation of a member of this protein family causes pleiotropic effects in many organisms and is causative of vitamin B6-dependent epilepsy in humans |
---|
Bibliography | 1.Ito T, Yamamoto K, Hori R, Yamauchi A, Downs DM, Hemmi H, Yoshimura T. Conserved Pyridoxal 5'-Phosphate-Binding Protein YggS Impacts Amino Acid Metabolism through Pyridoxine 5'-Phosphate in Escherichia coli. Appl Environ Microbiol. 2019 May 16;85(11):e00430-19. doi: 10.1128/AEM.00430-19. PMID: 30902856; PMCID: PMC6532037. |