Primary Information |
|---|
| BoMiProt ID | Bomi8520 |
|---|
| Protein Name | Pulmonary surfactant-associated protein D/Lung surfactant protein D/PSP-D/SP-D |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | P35246 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_851369.1 |
|---|
| Aminoacid Length | 369 |
|---|
| Molecular Weight | 37405 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | SFTPD |
|---|
| Gene ID | 282072 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | lung's defense against inhaled microorganisms, organic antigens and toxins. Extracellular reorganization or turnover of pulmonary surfactant. |
|---|
| Biochemical Properties | belongs to the collectin subgroup of C-type lectins.The polypeptide chain consists of a short N-terminal segment, participating in inter-chain disulfide bonding, a collagen-like region, an α-helical coiled-coil neck region and a C-terminal carbohydrate recognition domain (CRD). SP-D appear as cruci-formed tetramers. |
|---|
| Significance in milk | heavily expressed in the lung and the trachea but also in segments of the gastrointestinal tract, the mammary glands and the salivary glands. in bovines,function of lungs. |
|---|
| PTMs | Glycoprotein, Hydroxylation, S-nitrosylation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|P35246|SFTPD_BOVIN Pulmonary surfactant-associated protein D OS=Bos taurus OX=9913 GN=SFTPD PE=1 SV=2
MLLLPLSVLLLLTQPWRSLGAEMKIYSQKTMANACTLVMCSPPEDGLPGRDGRDGREGPR
GEKGDPGSPGPAGRAGMPGPAGPIGLKGDN*90GSAGEPGPKGDTGPPGPPGMPGPAGREGPS
GKQGSMGPPGTPGPKGDTGPKGGVGAPGIQGSPGPAGLKGERGAPGEPGAPGRAGAPGPA
GAIGPQGPSGARGPPGLKGDRGTPGERGAKGESGLAEVNALRQRVGILEGQLQRLQNAFS
QYKKAMLFPNGRSVGEKIFKTEGSEKTFQDAQQICTQAGGQLPSPRSAAENEALTQLATA
QNKAAFLSMSDTRKEGTFIYPTGEPLVYSNWAPQEPNNDGGSENCVEIFPNGKWNDKVCG
EQRLVICEF
|
|---|
| Predicted Disorder Regions | (34-201) |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | S-nitrosylation at Cys-35 and Cys-40 alters the quaternary structure which results in a pro-inflammatory chemoattractive signaling activity with macrophages. |
|---|
| Bibliography | Gjerstorff M, Madsen J, Bendixen C, Holmskov U, Hansen S. Genomic and molecular characterization of bovine surfactant protein D (SP-D). Mol Immunol. 2004 Jun;41(4):369-76. doi: 10.1016/j.molimm.2004.03.005. PMID: 15163533. |
|---|
