Primary Information |
|---|
| BoMiProt ID | Bomi8494 |
|---|
| Protein Name | Proton-coupled folate transporter/Heme carrier protein 1/Retinal pigment epithelium transporter/Solute carrier family 46 member 1 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q05B81 |
|---|
| Milk Fraction | Exosomes |
|---|
| Ref Sequence ID | NP_001073053.1 |
|---|
| Aminoacid Length | 459 |
|---|
| Molecular Weight | 50428 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | SLC46A1 |
|---|
| Gene ID | 511097 |
|---|
| Protein Existence Status | Reviewed |
|---|
Secondary Information |
|---|
| Presence in other biological fluids/tissue/cells | retina and retinal pigment epithelium |
|---|
| Protein Function | The proton-coupled folate transporter (PCFT-SLC46A1) is a protein by which folates are absorbed across the brush-border membrane of the small intestine. |
|---|
| Biochemical Properties | PCFT has twelve transmembrane domains (TMDs) with their N- and C-termini directed to the cytoplasm. |
|---|
| PTMs | N-acetylmethionine,N-Linked Glycosylation at Asn, Phosphorylation at Ser |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q05B81|PCFT_BOVIN Proton-coupled folate transporter OS=Bos taurus OX=9913 GN=SLC46A1 PE=2 SV=1
MEGRANSPGEPRAWPTRSVLCRGCVEPLVFLANFALVLQGPVTTQYLWHRFSADLGYN*58GT
RHRDSCSN*68HSVDPIAQEVETLTSHWTLYMNVGGFLVGLFSSTLLGAWSDCVGRRPLLVLA
SLGLLLQTVLSIFVVQLHLHIGYLVLGRILCALLGDFSGLLAASFASVADVSSSRTRTIR
MALLEACIGVAGMLASFIGGFLLQEQVYVNPFWLALAVLTVMTLYAAFCFGETVKERTPT
RLFTLRHHRSVIQLYVTQAPEKSRKHLALYSLAIFVMITVHLGAQDILTLYELSAPLCWD
SRLISYGSAAQQLPYLTSLLGLRLLQYCLADTWVAEIGLVFNILGMMVFAFATITPLMFT
GYGLLFLSLVVTPIIRAKLSRLVRQSEQGALFSALACVNGLAMLMASGIFNSLYPATLNL
MKGFPFLLAAGLLFIPAILMGILERDNHCPEFQEFSQS*458P
|
|---|
| Predicted Disorder Regions | 1-12, 57-71, 452-459 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | 11TMHs; (86-108), (115-137), ( 146-168), (181-203), (212-234), (266-284), (303-325), (332-354), (358-376), ( 389-410), (425-443) |
|---|
| Bibliography | 1.Sharma S, Dimasi D, Bröer S, Kumar R, Della NG. Heme carrier protein 1 (HCP1) expression and functional analysis in the retina and retinal pigment epithelium. Exp Cell Res. 2007 Apr 1;313(6):1251-9. doi: 10.1016/j.yexcr.2007.01.019. Epub 2007 Feb 6. PMID: 17335806. 2.Zhao R, Aluri S, Goldman ID. The proton-coupled folate transporter (PCFT-SLC46A1) and the syndrome of systemic and cerebral folate deficiency of infancy: Hereditary folate malabsorption. Mol Aspects Med. 2017 Feb;53:57-72. doi: 10.1016/j.mam.2016.09.002. Epub 2016 Sep 21. PMID: 27664775; PMCID: PMC5253092. |
|---|
