Primary Information |
|---|
| BoMiProt ID | Bomi8450 |
|---|
| Protein Name | Protein unc-119 homolog A |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q3SYR2 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001029817.1 |
|---|
| Aminoacid Length | 240 |
|---|
| Molecular Weight | 26987 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | UNC119 |
|---|
| Gene ID | 538501 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | unc-119 homolog is required for normal development of the zebrafish nervous system. |
|---|
| Biochemical Properties | HRG4-RRG4 showed 57% homology with unc-119, a Caenorhabditis elegans neuroprotein causing defects in locomotion, feeding, and chemosensation when mutated. |
|---|
| PTMs | Phosphorylation at Ser,N6-Acetylation at Lys, Isopeptide bond formation,Ubl conjugation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q3SYR2|U119A_BOVIN Protein unc-119 homolog A OS=Bos taurus OX=9913 GN=UNC119 PE=2 SV=1
MKVKKGGGGAGTGAEHAPGASGPNVEPKPELQAESES*37GS*39ES*41EPEAGPGPRPGPLQRKQPI
GPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKPPASERLPINPRD
LDPNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFG
FCIPSSKNTCEHIYDFPALSEELINEMIRHPYETQSDSFYFVDDRLVMHNKADYSYSGTP
|
|---|
| Predicted Disorder Regions | 1-66, 113-120, 236-240 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | Phosphorylation suppresses its interaction with KLHL18 and downregulates its KLHL18-mediated degradation. |
|---|
| Additional Comments | Loss of function of the unc-119 gene in C. elegans results in a disorganized neural architecture and paralysis. |
|---|
| Bibliography | 1.Manning AG, Crawford BD, Waskiewicz AJ, Pilgrim DB. unc-119 homolog required for normal development of the zebrafish nervous system. Genesis. 2004 Dec;40(4):223-30. doi: 10.1002/gene.20089. PMID: 15593328. 2.Higashide T, McLaren MJ, Inana G. Localization of HRG4, a photoreceptor protein homologous to Unc-119, in ribbon synapse. Invest Ophthalmol Vis Sci. 1998 Apr;39(5):690-8. PMID: 9538874. |
|---|
