Primary Information |
|---|
| BoMiProt ID | Bomi8441 |
|---|
| Protein Name | Protein transport protein Sec61 subunit gamma |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q3T104 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001035676.1 |
|---|
| Aminoacid Length | 68 |
|---|
| Molecular Weight | 7741 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | SEC61G |
|---|
| Gene ID | 615778 |
|---|
| Protein Existence Status | Reviewed |
|---|
Secondary Information |
|---|
| Presence in other biological fluids/tissue/cells | vertebral column |
|---|
| Protein Function | One of the component of SEC61 channel-forming translocon complex that mediates transport of signal peptide-containing precursor polypeptides across endoplasmic reticulum (ER).The SEC61 channel also cooperates with the translocating protein TRAM1 to import nascent proteins into the ER |
|---|
| PTMs | N-acetylation at Meth,Phosphorylation at Ser |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q3T104|SC61G_BOVIN Protein transport protein Sec61 subunit gamma OS=Bos taurus OX=9913 GN=SEC61G PE=3 SV=1
MDQVMQFVEPSRQFVKDS*18IRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIP
INNIIVGG
|
|---|
| Predicted Disorder Regions | 1-14, 17-32, 39-42 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | 1TMH;(36-54) |
|---|
