Primary Information |
|---|
| BoMiProt ID | Bomi8399 |
|---|
| Protein Name | Protein phosphatase methylesterase 1/PME-1 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q58DN4 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001069524.1 |
|---|
| Aminoacid Length | 380 |
|---|
| Molecular Weight | 41710 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | PPME1/PME-1 |
|---|
| Gene ID | 535390 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | Ppme1 is expressed in skeletal muscle and is upregulated in response to neurogenic muscle atrophy. Furthermore, inhibition of Ppme1 blocks muscle cell differentiation, dysregulates MAP kinase signaling via a non-canonical mechanism, and disrupts the interaction between Ppme1 and PP2A. |
|---|
| Biochemical Properties | Protein phosphatase methyl esterase (PME-1) catalyzes specifically the demethylation of the C-terminal Leu309 residue of PP2A catalytic subunit (PP2Ac). |
|---|
| PTMs | Methylation and Phosphorylation at Ser |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q58DN4|PPME1_BOVIN Protein phosphatase methylesterase 1 OS=Bos taurus OX=9913 GN=PPME1 PE=2 SV=3
MSALEKSMHLGRLPS*15RPPLPGSGGSQSGAKMRMGPGRKRDFS*42PVPWSQYFESMEDVEVEN
ETGKDTFRVYKSGSEGPVLLLLHGGGHSALSWAVFTAAIISRVQCRIVALDLRGHGETKV
RNSEDLSAETMAKDVGNVVEAMYGDLPPPIMLIGHSMGGAIAVHTASSNLVPSLLGLCMI
DVVEGTAMDALNSMQNFLRGRPKTFKSLENAIEWSVKSGQIRNLESARVSMVGQVKQCEG
ITSPEGSKSIVEGIIEEEEEDEEGSESVNKRKKEDDMETKKDHPYTWRIELAKTEKYWDG
WFRGLSNLFLSCPIPKLLLLAGVDRLDKDLTIGQMQGKFQMQVLPQCGHAVHEDAPDKVA
EAVATFLIRHRFAEPIGGFQ
|
|---|
| Predicted Disorder Regions | 1-50 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | The methylation of the C-terminal Leu309 residue of the catalytic subunit is an essential regulatory mechanism for proper function of the PP2A holoenzyme and is believed to enhance the affinity ofthe PP2A core enzyme for a subset of B regulatory subunits. |
|---|
| Additional Comments | Inhibition of protein phosphatase methylesterase 1 dysregulates MAP kinase signaling and attenuates muscle cell differentiation |
|---|
| Bibliography | 1.Yabe R, Miura A, Usui T, Mudrak I, Ogris E, Ohama T, Sato K. Protein Phosphatase Methyl-Esterase PME-1 Protects Protein Phosphatase 2A from Ubiquitin/Proteasome Degradation. PLoS One. 2015 Dec 17;10(12):e0145226. doi: 10.1371/journal.pone.0145226. PMID: 26678046; PMCID: PMC4683032. 2.Labuzan SA, Lynch SA, Cooper LM, Waddell DS. Inhibition of protein phosphatase methylesterase 1 dysregulates MAP kinase signaling and attenuates muscle cell differentiation. Gene. 2020 May 20;739:144515. doi: 10.1016/j.gene.2020.144515. Epub 2020 Feb 26. PMID: 32112987. 3.Yabe, R., S. Tsuji, S. Mochida, T. Ikehara, T. Usui, T. Ohama, and K. Sato. 2018. 'A stable
association with PME-1 may be dispensable for PP2A demethylation - implications for the
detection of PP2A methylation and immunoprecipitation', FEBS Open Bio, 8: 1486-96. |
|---|
