Primary Information |
---|
BoMiProt ID | Bomi8359 |
---|
Protein Name | Protein lifeguard 2/Fas apoptotic inhibitory molecule 2 |
---|
Organism | Bos taurus |
---|
Uniprot ID | Q1LZ71 |
---|
Milk Fraction | Whey |
---|
Ref Sequence ID | NP_001068886.1 |
---|
Aminoacid Length | 316 |
---|
Molecular Weight | 35184 |
---|
FASTA Sequence |
Download |
---|
Gene Name | FAIM2/LFG2 |
---|
Gene ID | 509790 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | an antiapoptotic protein,Regulates Fas-mediated apoptosis in neuronal cells by interfering with Activating caspase 8,Plays a significant role in the development of cerebellum. |
---|
Biochemical Properties | 1.DEAD-box proteins share a structurally similar core of two RecA-like domains (RecA_N and RecA_C) that contain the conserved motifs for ATP-dependent RNA unwinding. 2.Allosteric regulation of core activities by RNA-induced movement of ancillary domains may constitute a general regulatory mechanism of DEAD-box protein activity. |
---|
PTMs | N-linked glycosylation and phosphorylation |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q1LZ71|LFG2_BOVIN Protein lifeguard 2 OS=Bos taurus OX=9913 GN=FAIM2 PE=2 SV=1
MTQGKLSVANKAPGTEGQQQANGEKKETPAVPSAPPSYEEATSGEGLKAGAFPPAPSAVP
LHPSWAYVDPNSSSSYESGFPTGDHEFFTTFSWDDQKVRRVFIRKVYTILLIQLLVTLGV
VALFTFCDPVKDYVQANPGWYWASYAVFFATYLTLACCSGPRRHFPWNLILLTIFTLSMA
YLTGMLSSYYN*191TTSVLLCLSITALVCLSVTVFSFQTKFDFTSCQGVLFVLLMTLFFSGLI
LAILLPFQYVPWLHAVYAVLGAGVFTLFLAFDTQLLMGSRRHSLSPEEYIFGALNIYLDI
IYIFTFFLQLFGTNRE
|
---|
Predicted Disorder Regions | (1-88) |
---|
DisProt Annotation | |
---|
TM Helix Prediction | 7TMHs; (106-124),(139-157),(164-186),(192-214),(227-245),(249-271),(291-313) |
---|
Significance of PTMs | Activation of FAS death receptor via FAS-ligand led to JNK-mediated FAIM2 phosphorylation, decreased proteasome-mediated degradation and increased association with the FAS receptor |
---|
Additional Comments | functions as a growth switch in juvenile zebrafish. |
---|
Bibliography | 1.Pawar M, Busov B, Chandrasekhar A, Yao J, Zacks DN, Besirli CG. FAS apoptotic inhibitory molecule 2 is a stress-induced intrinsic neuroprotective factor in the retina. Cell Death Differ. 2017 Oct;24(10):1799-1810. doi: 10.1038/cdd.2017.109. Epub 2017 Jul 14. PMID: 28708137; PMCID: PMC5596422. 2.Bucan V, Reimers K, Choi CY, Eddy MT, Vogt PM. The anti-apoptotic protein lifeguard is expressed in breast cancer cells and tissues. Cell Mol Biol Lett. 2010 Jun;15(2):296-310. doi: 10.2478/s11658-010-0009-1. Epub 2010 Mar 19. PMID: 20336406; PMCID: PMC6275920. 3.1.Samatanga B, Andreou AZ, Klostermeier D. Allosteric regulation of helicase core activities of the DEAD-box helicase YxiN by RNA binding to its RNA recognition motif. Nucleic Acids Res. 2017 Feb |