Primary Information |
|---|
| BoMiProt ID | Bomi8296 |
|---|
| Protein Name | Proteasomal ubiquitin receptor ADRM1 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | A1L5A6 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001073751.1 |
|---|
| Aminoacid Length | 407 |
|---|
| Molecular Weight | 41955 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | ADRM1 |
|---|
| Gene ID | 519729 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins.It participates in numerous cellular processes, including cell cycle progression, apoptosis, or DNA damage repair. |
|---|
| Biochemical Properties | Component of the 19S proteasome regulatory particle complex. The 26S proteasome consists of a 20S core particle (CP) and two 19S regulatory subunits (RP).The Pru (pleckstrin-like receptor for ubiquitin) domain mediates interactions with PSMD1 and ubiquitin. Preferential binding to the proximal subunit of K48-linked diubiquitin allows UCHL5 access to the distal subunit.The deduced 407-amino acid ADRM1 protein has a calculated molecular mass of 41.2 kD. It has a putative N-terminal signal sequence, a potential C-terminal transmembrane region, and numerous sites for O- and N-glycosylation.The deduced 407-amino acid mouse protein shares 96% identity with the human protein.
Interacts with the proteasomal scaffolding protein PSMD1. |
|---|
| PTMs | Acetylation, Isopeptide bond, Phosphorylation,Ubl conjugation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|A1L5A6|ADRM1_BOVIN Proteasomal ubiquitin receptor ADRM1 OS=Bos taurus OX=9913 GN=ADRM1 PE=2 SV=1
MTTSGALFPSLVPGS*15RGSSNKYLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFC
WKDRTSGNVEDDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEH
CRKVNEY*127LNNPPMPGALGAS*140GSGGHELSALGGEGGLQSLLGNMSHSQLMQLIGPAGLGGL
GGLGALTGPGLASLLGSGGPPASSSSSSSRS*211QSAAVT*217PSSTTSSTRATPAPSAPAAASAT
SPSPAPSSGDGASTAASPAQPIQLSDLQSILATMSVPAGPGGGQQVDLASVLTPEIMAPI
LANADVQERLLPYLPSGESLPQTAEEIQNTLTSPQFQQALGMFSAALASGQLGPLMCQFG
LPAEAVEAANKGDVEAFAKAMQNSASPEQQEGDGKDKKDEEEDMS*405LD
|
|---|
| Predicted Disorder Regions | 1-11, 35-38, 116-156, 174-180, 190-283, 291-302, 343-351, 363-407 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Bibliography | 1.Simins AB, Weighardt H, Weidner KM, Weidle UH, Holzmann B. Functional cloning of ARM-1, an adhesion-regulating molecule upregulated in metastatic tumor cells. Clin Exp Metastasis. 1999;17(8):641-8. doi: 10.1023/a:1006790912877. PMID: 10919708. 2.Husnjak K, Elsasser S, Zhang N, Chen X, Randles L, Shi Y, Hofmann K, Walters KJ, Finley D, Dikic I. Proteasome subunit Rpn13 is a novel ubiquitin receptor. Nature. 2008 May 22;453(7194):481-8. doi: 10.1038/nature06926. PMID: 18497817; PMCID: PMC2839886. |