Primary Information |
|---|
| BoMiProt ID | Bomi8293 |
|---|
| Protein Name | Prostaglandin reductase 1/PRG-1 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q3SZJ4 |
|---|
| Milk Fraction | Whey,MFGM |
|---|
| Ref Sequence ID | NP_001030358.1 |
|---|
| Aminoacid Length | 329 |
|---|
| Molecular Weight | 35706 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | PTGR1/LTB4DH |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Presence in other biological fluids/tissue/cells | Human intestine,testis,muscle tissues,cerebral cortex,kidney and liver,porcine kidney |
|---|
| Protein Function | Prostaglandin Reductase 1 (PTGR1) is a rate-limiting enzyme involved in the arachidonic acid metabolism pathway.deactivation of some eicosanoids, including prostaglandins and leukotriene B4. |
|---|
| Biochemical Properties | reduces the α,β-double bond in 15-keto-PGs and carbonyl compounds.Arg56 is predicted to interact with the side-chain carboxyl group of prostaglandins.PGs (such as PGE2, PGJ2, and PGF2α) are converted into 15-keto-PGs first by NAD-dependent 15-hydroxyprostaglandin dehydrogenase (15-PGDH), and then further metabolized into biologically less active 13,14-dihydro-15-keto-PGs by PTGR1. Similarly, LXA4 is oxidized to 15-keto-LXA4 by 15-PGDH and subsequently converted to 13,14-dihydro-15-keto-LXA4 by PTGR1. In comparison to 15-keto-PGE1, 15-keto-PGF1α, 15-keto-PGF2α, and LTB4, 15-keto-PGE2 is the best substrate for PTGR1 with the highest kcat/Km value. For example, the kcat/Km value for 15-keto-PGE2 reduction is approximately 200 times higher than that for LTB4 oxidation. |
|---|
| PTMs | Acetylation on Lys and phosphorylation on Ser and Thr |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q3SZJ4|PTGR1_BOVIN Prostaglandin reductase 1 OS=Bos taurus OX=9913 GN=PTGR1 PE=2 SV=1
MVHAKSWTLKKHFVGYPT*18NS*20DFELKTVELPPLKDGEVLLEALYLTVDPYMRIMAKSLKEG
DMMMGEQVARVVESKNSAFPTGTIVLAPSGWTTHSISNGEKLEKVLAEWPDTLPLSLALG
TVGMPGLTAYFGLLDICGVKGGETVLVSAAAGAVGSIVGQIAKLKGCKVVGTAGSDEKVA
WLKKHGFDVALNYKTVKSLEEALKEAAPEGYDCYFDNVGGEFSNVAITQMKKFGRIAICG
AISVYNRTSPLSPGPSPEIIIFKELHLQGFVVYRWQGEVRQKALRDLLKWVSEGKIQYHE
HVTEGFENMPAAFIGLLKGENLGKAIVKA
|
|---|
| Predicted Disorder Regions | NA |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Bibliography | Wang X, Yin G, Zhang W, Song K, Zhang L, Guo Z. Prostaglandin Reductase 1 as a Potential Therapeutic Target for Cancer Therapy. Front Pharmacol. 2021 Aug 6;12:717730. doi: 10.3389/fphar.2021.717730. PMID: 34421612; PMCID: PMC8377670. |
|---|
