Primary Information |
|---|
| BoMiProt ID | Bomi8289 |
|---|
| Protein Name | Prostaglandin E synthase 3/Cytosolic prostaglandin E2 synthase |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q3ZBF7 |
|---|
| Milk Fraction | Exosomes |
|---|
| Ref Sequence ID | NP_001007807.2 |
|---|
| Aminoacid Length | 160 |
|---|
| Molecular Weight | 18697 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | PTGES3 |
|---|
| Gene ID | 493638 |
|---|
| Protein Existence Status | Reviewed |
|---|
Secondary Information |
|---|
| Presence in other biological fluids/tissue/cells | Detected in testis and ovary, at lower levels in endometrium, myometrium, kidney and lung, and only faintly in spleen, heart and muscle (at protein level). Expressed at high levels in glandular and luminal epithelial cells of the endometrium, but also detected in stromal cells |
|---|
| Protein Function | Prostaglandin E synthases (PGESs) convert cyclooxygenase (COX)-derived prostaglandin H2 (PGH2) into prostaglandin E2 (PGE2) and comprise at least three types of structurally and biologically distinct enzymes. |
|---|
| PTMs | N6-Acetylation at Lys, Isopeptide bond formation, Phosphorylation at Ser, Ubl conjugation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q3ZBF7|TEBP_BOVIN Prostaglandin E synthase 3 OS=Bos taurus OX=9913 GN=PTGES3 PE=1 SV=1
MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGS*44DNFKHLNEIDLFHCID
PNDSKHKRTDRSILCCLRKGESGQS*85WPRLTKERAKLNWLS*100VDFNNWKDWEDDS*113DEDMS*118NF
DRFSEMMNNMGGDEDVDLPEVDGADDDS*148QDS*152DDEKMPDLE
|
|---|
| Predicted Disorder Regions | 1-7, 68-75, 107-160 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Bibliography | 1.Xu D, Cai J, Wan ZK, Gao H, Sun Y. Pathophysiological role of prostaglandin E synthases in liver diseases. Prostaglandins Other Lipid Mediat. 2021 Jun;154:106552. doi: 10.1016/j.prostaglandins.2021.106552. Epub 2021 Apr 27. PMID: 33930567. |
|---|
