Primary Information |
|---|
| BoMiProt ID | Bomi8288 |
|---|
| Protein Name | Prostaglandin E synthase 2 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q66LN0 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001160026.1 |
|---|
| Aminoacid Length | 372 |
|---|
| Molecular Weight | 41738 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | PTGES2 |
|---|
| Gene ID | 493639 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Presence in other biological fluids/tissue/cells | Mainly detected in heart,followed by lungs,muscle,kidney and testis.In endometrium, it is mainly expressed in luminal epithelial cells. |
|---|
| Protein Function | involved in the pathway prostaglandin biosynthesis, which is part of Lipid metabolism. |
|---|
| Biochemical Properties | This isomerase catalyzes the conversion of PGH2 into the more stable prostaglandin E2.The Vmax and Km values for PGH2 of the purified recombinant mPGE synthase are about 3.3 μmol/min · mg of protein and 28 μM, respectively.Activated by various SH-reducing reagents, i.e., dithiothreitol, glutathione (GSH), and β-mercaptoethanol, in order of decreasing effectiveness. |
|---|
| Significance in milk | During the estrus cycle, it decreases from the beginning of the cycle until days 13-15 and then increase until ovulation. |
|---|
| PTMs | Phosphorylation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q66LN0|PGES2_BOVIN Prostaglandin E synthase 2 OS=Bos taurus OX=9913 GN=PTGES2 PE=1 SV=3
MAHAVRALWPHGRALAWRLGDRPALGLHAQSRAGFTGAAGGSGPAATARKGGPRLLGAAA
LALGGALGLYHTARWHLRAQDLRAERSATQLS*92LSSRLQLTLYQYKTCPFCSKVRAFLDFH
ALPYQVVEVNPVRRAEIKFSSYRKVPIVMAQEGESLQQLNDSSVIISALKTYLVSGQPLA
DIITYYPPMKAVNDQGKEVTEFCNKYWLMLDEKEAQRMYGGKEARTEEMKWRQWADDWLV
HLISPNVYRTPAEALASFDYIVKEGNFGTVEGAMAKYMGAAAMYFISKRLKRRHHLRDDV
REDLYEAANKWVAAVGKDRPFMGGQKPNLADLAVYGVLRVMEGLEAFDDLMRHTHIQPWY
LRVEKAIAEAPQ
|
|---|
| Predicted Disorder Regions | NA |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Bibliography | Tanikawa N, Ohmiya Y, Ohkubo H, Hashimoto K, Kangawa K, Kojima M, Ito S, Watanabe K. Identification and characterization of a novel type of membrane-associated prostaglandin E synthase. Biochem Biophys Res Commun. 2002 Mar 8;291(4):884-9. doi: 10.1006/bbrc.2002.6531. PMID: 11866447. |
|---|
