Search by BoMiProt ID - Bomi8279


Primary Information

BoMiProt ID Bomi8279
Protein Name Propionyl-CoA carboxylase beta chain, mitochondrial/PCCase subunit beta/Propanoyl-CoA:carbon dioxide ligase subunit beta
Organism Bos taurus
Uniprot IDQ2TBR0
Milk FractionWhey
Ref Sequence ID NP_001033637.1
Aminoacid Length 539
Molecular Weight 58311
FASTA Sequence Download
Gene Name PCCB
Gene ID 515902
Protein Existence Status reviewed

Secondary Information

Protein Function catalyzes the carboxylation of propionyl-CoA to methylmalonyl-CoA 
Biochemical Properties a protein of 58 kDa, 539 amino acids
PTMs Acetylation, Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2TBR0|PCCB_BOVIN Propionyl-CoA carboxylase beta chain, mitochondrial OS=Bos taurus OX=9913 GN=PCCB PE=2 SV=1 MAAAMRVAVAGARLSVVLRSLRGAGRSLCTQPVSVNERIENKRQAALLGGGQRRIDAQHK RGKLTARERIS*71LLLDPGSFVESDMFVEHRCADFGMAADKNKFPGDSVVTGRGRINGRLVY VFSQDFTVFGGSLSGAHAQKICKIMDQALTVGAPVIGLNDSGGARIQEGVESLAGYADIF LRNVTASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVT QEELGGARTHTTMSGVAHRAFENDVDALCNLREFFNYLPLSNQDPAPVLECHDPSDRLVP ELDTIVPLESTKAYNMVDIIHAVVDEREFFEIMPNYAKNIIVGFARMNGRTVGIVGNQPK VASGCLDINSSVKGARFVRFCDSFNIPLITFVDVPGFLPGTAQEYGGIIRHGAKLLYAFA EATVPKVTVITRKAYGGAYDVMSSKHLCGDTNYAWPTAEIAVMGAKGAVEIIFKGHENVE AAQAEYIEKFANPFPAAVRGFVDDIIQPSSTRARICCDLDVLASKKVQRPWRKHANIPL
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction no TM helices
Bibliography Wongkittichote P, Ah Mew N, Chapman KA. Propionyl-CoA carboxylase - A review. Mol Genet Metab. 2017 Dec;122(4):145-152. doi: 10.1016/j.ymgme.2017.10.002. Epub 2017 Oct 7. PMID: 29033250; PMCID: PMC5725275.