Primary Information |
|---|
| BoMiProt ID | Bomi8271 |
|---|
| Protein Name | Pro-opiomelanocortin |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | P01190 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_776576.1 |
|---|
| Aminoacid Length | 265 |
|---|
| Molecular Weight | 29260 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | POMC |
|---|
| Gene ID | 281416 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | It is involved in cortisol release by stimulating the adrenal gland. |
|---|
| Significance in milk | regulation of appetite and blood pressure |
|---|
| PTMs | Acetylation, Amidation, Cleavage on pair of basic residues, Disulfide bond formation, Glycosylation, Phosphorylation, Pyrrolidone carboxylic acid, Sulfation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|P01190|COLI_BOVIN Pro-opiomelanocortin OS=Bos taurus OX=9913 GN=POMC PE=1 SV=1
MPRLCSSRSGALLLALLLQASMEVRGWCLESSQCQDLTTESNLLACIRACKPDLSAETPV
FPGNGDEQPLT*71ENPRKYVMGHFRWDRFGRRN*91GSSSSGVGGAAQKREEEVAVGEGPGPRGD
DAETGPREDKRSYSMEHFRWGKPVGKKRRPVKVYPNGAEDES*162AQAFPLEFKRELTGERLE
QARGPEAQAESAAARAELEYGLVAEAEAEAAEKKDSGPYKMEHFRWGSPPKDKRYGGFMT
SEKSQTPLVTLFKNAIIKNAHKKGQ
|
|---|
| Predicted Disorder Regions | (1-9), (52-244), (258-265) |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | presence of an O-linked oligosaccharide at threonine45 and an N-linked oligosaccharide at asparagine65.Asparagine 65 is part of the tripeptide sequence –Asn-Gly-Ser- which is a classical recognition site for the enzyme that brings about N-glycosylation. |
|---|
| Bibliography | 1.James S, Bennett HP. Use of reversed-phase and ion-exchange batch extraction in the purification of bovine pituitary peptides. J Chromatogr. 1985 Jun 19;326:329-38. doi: 10.1016/s0021-9673(01)87458-6. PMID: 4030947. 2.Nakanishi, S., Inoue, A., Kita, T., Nakamura, M., Chang, A. C., Cohen, S. N., & Numa, S. (1979). Nucleotide sequence of cloned cDNA for bovine corticotropin-beta-lipotropin precursor. Nature, 278(5703), 423–427. https://doi.org/10.1038/278423a0 |
|---|
