Primary Information |
---|
BoMiProt ID | Bomi8257 |
---|
Protein Name | Proline/serine-rich coiled-coil protein 1 |
---|
Organism | Bos taurus |
---|
Uniprot ID | Q29RJ9 |
---|
Milk Fraction | Whey |
---|
Ref Sequence ID | NP_001039966.1 |
---|
Aminoacid Length | 326 |
---|
Molecular Weight | 34326 |
---|
FASTA Sequence |
Download |
---|
Gene Name | PSRC1 |
---|
Gene ID | 541250 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | PSRC1 protects against the development of atherosclerosis and enhances the stability of plaques by modulating cholesterol transportation and inflammation in macrophages and the liver of apoE-/- mice. |
---|
Biochemical Properties | Psrc1 may mediate the interactions between p53 and other signaling pathways and contribute to the complexity and specificity of the p53 signaling network. |
---|
PTMs | Phosphorylation at Ser/Thr |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q29RJ9|PSRC1_BOVIN Proline/serine-rich coiled-coil protein 1 OS=Bos taurus OX=9913 GN=PSRC1 PE=2 SV=1
MEDLEEDVKFIADETLDFGGLS*22PSDSREEEDVAVLVTPEKPLRRGLS*47HRSDPNAVAPTPQ
GLRLS*65LGPLS*70PEKLEEILHEANRLAAQLEQCALKERENTGEGSGPRRVKPSPRRETFVLK
DS*122PVRDLLPTVSSLARSTPS*140PSSLT*145PRLRSSDRKGSIRALRATSGKKPSSVKRESPTCNL
FPASKS*186PASS*190PLARSAPPVRGKAGPSGRATASPPTPVRPVLAPQPPAGSSQRPSRPQGAA
AKPSSRLPVPSAVPRPGNRMPLASRSVPSSKGAPPSDSLSARKGLPRPSAAGHRVPVSQR
PNLPISGAGRSNLQPPRKVAVPGSTR
|
---|
Predicted Disorder Regions | 1-80, 86-257, 267-294, 319-326 |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Additional Comments | PSRC1 overexpression attenuates atherosclerosis progression in apoE -/- mice by modulating cholesterol transportation and inflammation |
---|
Bibliography | 1.Guo K, Hu L, Xi D, Zhao J, Liu J, Luo T, Ma Y, Lai W, Guo Z. PSRC1 overexpression attenuates atherosclerosis progression in apoE-/- mice by modulating cholesterol transportation and inflammation. J Mol Cell Cardiol. 2018 Mar;116:69-80. doi: 10.1016/j.yjmcc.2018.01.013. Epub 2018 Feb 3. PMID: 29378206. |