Primary Information |
---|
BoMiProt ID | Bomi8228 |
---|
Protein Name | Probetacellulin |
---|
Organism | Bos taurus |
---|
Uniprot ID | Q9TTC5 |
---|
Milk Fraction | Whey |
---|
Ref Sequence ID | NP_776321.2 |
---|
Aminoacid Length | 178 |
---|
Molecular Weight | 19640 |
---|
FASTA Sequence |
Download |
---|
Gene Name | BTC |
---|
Gene ID | 280737 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Presence in other biological fluids/tissue/cells | present in the pancreas,plays role in the differentiation of pancreatic β cells. |
---|
Protein Function | A neonatal developmental protein.Serves as growth factor which binds to EGFR, ERBB4 and other EGF receptor family members.Potent mitogen for retinal pigment epithelial cells and vascular smooth muscle cells. |
---|
Biochemical Properties | Contains a signal peptide,the extracellular region including EGF like domain,a transmebrane domain and a cytosolic tail.BTC EGF-like motif includes six conserved cysteine residues with three disulfide-bonded intramolecular loops (A-loop: Cys69–Cys82; B-loop: Cys77–Cys93; C-loop: Cys95–Cys104).Human BTC contains RGD sequence which facilitate binding to integrin thus cell to cell ineraction. |
---|
Significance in milk | neonatal developmental protein |
---|
PTMs | Disulfide bond formation,Glycosylation |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q9TTC5|BTC_BOVIN Probetacellulin OS=Bos taurus OX=9913 GN=BTC PE=2 SV=1
MARAAPGSGASPLPLLPALALGLVILHCVVADGN*34STRSPEDDGLLCGDHAENCPATTTQP
KRRGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYAGARCERVDLFYLRGDRGQIL
VICLIAVMVIFIILVVSICTCCHPLRKRRKRRKKEEEMETLGKDITPINDDIQETSIA
|
---|
Predicted Disorder Regions | 5; (2 short and 3 long) predicted disordered segments.(1-10), 49th residue, 58th residue, (68-72), (153-178) |
---|
DisProt Annotation | NA |
---|
TM Helix Prediction | 2 TMHs: (13 to 21 ) and (117 -139) |
---|
Significance of PTMs | BTC contains six conserved cysteine residues with three disulfide-bonded intramolecular loops (A-loop: Cys69–Cys82; B-loop: Cys77–Cys93; C-loop: Cys95–Cys104).The most important PTM of BTC is ectodomain shedding,the proteolytic release of a soluble growth factor able to bind and activate ERBB receptors in neighboring cells (paracrine signaling) or in the cell of its origin (autocrine signaling).Mature human BTC contains 80 amino acids, extending from Asp32 to Tyr111. |
---|
Bibliography | Dahlhoff M, Wolf E, Schneider MR. The ABC of BTC: structural properties and biological roles of betacellulin. Semin Cell Dev Biol. 2014 Apr;28:42-8. doi: 10.1016/j.semcdb.2014.01.002. Epub 2014 Jan 15. PMID: 24440602. |