Primary Information |
|---|
| BoMiProt ID | Bomi8198 |
|---|
| Protein Name | Pre T-cell antigen receptor alpha/pT-alpha/pT-alpha-TCR/pTa |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q0VCS0 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001069101.1 |
|---|
| Aminoacid Length | 319 |
|---|
| Molecular Weight | 33670 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | PTCRA |
|---|
| Gene ID | 513669 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | The pre-T-cell receptor (pre-TCR) has a crucial role in the normal development of alphabeta T cells. |
|---|
| Biochemical Properties | The pre-TCR comprises an invariant α-chain (pre-Tα) that pairs with any TCR β-chain (TCRβ) following successful TCR β-gene rearrangement.The pre-Tα chain comprised a single immunoglobulin-like domain that is structurally distinct from the constant (C) domain of the TCR α-chain; nevertheless, the mode of association between pre-Tα and TCRβ mirrored that mediated by the Cα-Cβ domains of the αβTCR. |
|---|
| PTMs | Disulfide bond formation, N-Linked Glycosylation at Asn |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q0VCS0|PTCRA_BOVIN Pre T-cell antigen receptor alpha OS=Bos taurus OX=9913 GN=PTCRA PE=2 SV=1
MAESWLLLLLALGCPALPTEVTTLLRPAQQGMGSTPFPSLAPPITLLVDGKQQTLVVCLV
LDVAPPGFESPIWFSAGN*78GSSLDAFTYGPSPAEDGTWTRLAQLSLYSEELAAWDTLVCHT
GPGAGDHGQSTQPLQLSGDASSARTCLWEPLRGTRALVLRLGALRLLLFKLLLLDVLLTC
GRLHAPPAARGDPAGASGPGAPSLPAPHEVPRADSRLLPQPPPPRGSSSGPADRIRRNHG
GTTGRGLSVSASPPLEPRDRRRRVHTRRPRRDPRNPVWEEGPPVLRAWSSGPSFSLSTSS
LGAFLCNLPPPADPSFPGG
|
|---|
| Predicted Disorder Regions | 120-137, 186-291, 312-319 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Additional Comments | The pre-TCR head-to-tail dimerization creates two new interfaces, each involving the C9CGF b-sheet of pre-Ta from one receptor interacting with the b-sheet of the unpaired Vb domain from the other |
|---|
| Bibliography | 1.von Boehmer H. Unique features of the pre-T-cell receptor alpha-chain: not just a surrogate. Nat Rev Immunol. 2005 Jul;5(7):571-7. doi: 10.1038/nri1636. PMID: 15999096. 2.Pang SS, Berry R, Chen Z, Kjer-Nielsen L, Perugini MA, King GF, Wang C, Chew SH, La Gruta NL, Williams NK, Beddoe T, Tiganis T, Cowieson NP, Godfrey DI, Purcell AW, Wilce MC, McCluskey J, Rossjohn J. The structural basis for autonomous dimerization of the pre-T-cell antigen receptor. Nature. 2010 Oct 14;467(7317):844-8. doi: 10.1038/nature09448. PMID: 20944746. |